Bioinformatyka. (wykład monograficzny) wykład 5. E. Banachowicz. Zakład Biofizyki Molekularnej IF UAM

Wielkość: px
Rozpocząć pokaz od strony:

Download "Bioinformatyka. (wykład monograficzny) wykład 5. E. Banachowicz. Zakład Biofizyki Molekularnej IF UAM"

Transkrypt

1 Bioinformatyka (wykład monograficzny) wykład 5. E. Banachowicz Zakład Biofizyki Molekularnej IF UM lgorytmy macierze punktowe (DotPlot) programowanie dynamiczne metody heurystyczne (BLS, FS) metody statystyczne (modele Markova, statystyka Bayesa) Rodzaje dopasowań pokrycie sekwencji globalne, lokalne liczba sekwencji porównywanych para (pairwise sequence alignment) więcej niż dwie (multiple sequences alignment) Wykład 5,

2 Pokrycie sekwencji dopasowanie globalne dopasowanie wzdłuż całej sekwencji (zastosowanie: do białek składających się z pojedynczej domeny lub homologicznych słabo zróżnicowanych) dopasowanie lokalne uwzględnia domenową naturę białek, szuka subsekwencji (zastosowanie: do białek wielodomenowych, mrn z sekwencją genomową) DotPlot- Dotter Dotter: wykrywają fragmenty powtarzalne i rearanżacje opierają się na ocenie wizualnej czasami skuteczniejszej niż alignment idealny do szukania lokalnego podobieństwa Przykład: czynnik krzepnięcia XII (F12) aktywator tkankowo specyficznego plazminogenu (PL) (Bioinformatyka. Podręcznik do analizy genów i białek..d. Baxevanis, B.F.F. Quellette, PWN, 2005 ) Wykład 5,

3 Dotter - sekwencje Dotter - sekwencje Wykład 5,

4 Dotter SMR (http://smart.embl-heidelberg.de/) >gi gb H PL protein [Homo sapiens] >gi gb coagulation factor XII FN1 fibrynonektyna typ I, powtarzalna jednostka FN2 fibrynonektyna typ II, powtarzalna jednostka EF moduł nabłonkowego czynnika wzrostu KR domena typu kringle ryp SPc domena katalityczna zapewniająca aktywność proteinazy serynowej Wykład 5,

5 czynnik krzepnięcia krwi aktywator tkankowo specyficznego plazminogenu czynnik krzepnięcia krwi aktywator tkankowo specyficznego plazminogenu Wykład 5,

6 czynnik krzepnięcia krwi aktywator tkankowo specyficznego plazminogenu Dotter niektóre układy punktów tworząścieżkę każda ścieżka odpowiada jednemu dopasowaniu M Y S E Q U E N E H I S S E Q E N E H I S S E Q E N E M Y S E Q U E N E M Y S E Q U E N E H I S S E Q E N E znaleźć najlepszą ścieżkę! Wykład 5,

7 Najlepsza ścieżka Madryt Poznań optymalna? najszybsza? najkrótsza? Najlepsza ścieżka? Wykład 5,

8 lgorytm Needlemana-Wunscha strategia najlepszej ścieżki programowanie dynamiczne przeszukiwanie dotyczy pełnego zakresu sekwencji (obszaru dopasowania)- dopasowanie globalne każda podścieżka stanowić może fragment optymalnej ścieżki. Ścieżki szuka się poszerzając zakres podscieżek. Needlemann, Wunch (1970) J.Mol.Biol. 48, Sekwencja Sekwencja Sekwencja Sekwencja B Sekwencja B Sekwencja B Wykład 5,

9 lgorytm Smitha-Watermana dopasowanie lokalne ścieżka dopasowania nie musi osiągać krawędzi analizowanej sekwencji ścieżka jest lokalnie optymalna jeśli jej wydłużanie/skracanie nie poprawia obliczonej dla niej wartości system wartościowania dopasowania zaniża wartości w regionach słabego dopasowania = przerwanie ścieżki mogą istniećścieżki złożone z kilku połączonych ścieżek Smith, Waterman (1981) J.Mol.Biol. 147, Szukanie wielu dopasowań -subdopasowania Metoda optymalna daje zawsze najlepsze dopasowanie nawet jeśli nie ma ono znaczenia biologicznego znaczących, niezachodzących na siebie dopasowń lokalnych można naleźć kilka subdopasownia rzeba szukać więcej niż jednego dopasowania! (lalign, SIM) Przykład: zynnik krzepnięcia IX (F9, SWISS-PRO P00740) zynnik krzepnięcia XII (F12, SWISS-PRO P00748) Wykład 5,

10 Dopasowanie optymalne i suboptymalne >sp P00740 F9_HUMN oagulation factor IX precursor (E ) >sp P00740 F9_HUMN oagulation factor IX precursor (E ) (hristmas (hristmas factor) factor) (Plasma (Plasma thromboplastin thromboplastin component) component) (P) (P) [ontains: [ontains: oagulation oagulation factor factor IXa IXa light light chain; chain; oagulation oagulation factor factor IXa IXa heavy heavy chain] chain] - - Homo Homo sapiens sapiens (Human). (Human). MQRVNMIMESPLIILLYLLSEVFLDHENNKILNRPKRYNSKLEEFVQNL MQRVNMIMESPLIILLYLLSEVFLDHENNKILNRPKRYNSKLEEFVQNL EREMEEKSFEEREVFENEREFWKQYVDDQESNPLNSKDDINSYEWP EREMEEKSFEEREVFENEREFWKQYVDDQESNPLNSKDDINSYEWP FFEKNELDVNIKNREQFKNSDNKVVSEYRLENQKSEPVPFPR FFEKNELDVNIKNREQFKNSDNKVVSEYRLENQKSEPVPFPR VSVSQSKLREVFPDVDYVNSEEILDNIQSQSFNDFRVVEDKPQFPW VSVSQSKLREVFPDVDYVNSEEILDNIQSQSFNDFRVVEDKPQFPW QVVLNKVDFSIVNEKWIVHVEVKIVVEHNIEEEHEQKRNVIRII QVVLNKVDFSIVNEKWIVHVEVKIVVEHNIEEEHEQKRNVIRII PHHNYNINKYNHDILLELDEPLVLNSYVPIIDKEYNIFLKFSYVSWRVF PHHNYNINKYNHDILLELDEPLVLNSYVPIIDKEYNIFLKFSYVSWRVF HKRSLVLQYLRVPLVDRLRSKFIYNNMFFHERDSQDSPHVEVE HKRSLVLQYLRVPLVDRLRSKFIYNNMFFHERDSQDSPHVEVE SFLIISWEEMKKYIYKVSRYVNWIKEKKL SFLIISWEEMKKYIYKVSRYVNWIKEKKL >sp P00748 F12_HUMN >sp P00748 F12_HUMN oagulation oagulation factor factor XII XII precursor precursor (E (E ) ) (Hageman (Hageman factor) factor) (HF) (HF) [ontains: [ontains: oagulation oagulation factor factor XIIa XIIa heavy heavy chain; chain; Betafactor XIIa part 1; Beta-factor XIIa part 2; oagulation factor XIIa light Betafactor XIIa part 1; Beta-factor XIIa part 2; oagulation factor XIIa light chain] - Homo sapiens (Human). chain] - Homo sapiens (Human). MRLLLLFLLVSLESLSIPPWEPKEHKYKEEHVVLVEPHFPFQYHRQLYHK MRLLLLFLLVSLESLSIPPWEPKEHKYKEEHVVLVEPHFPFQYHRQLYHK HKRPPQPWPNFDQDQRWYLEPKKVKDHSKHSPQKVNMPSPHL HKRPPQPWPNFDQDQRWYLEPKKVKDHSKHSPQKVNMPSPHL PQHLNHQKEKFEPQLLRFFHKNEIWYREQVRQKPDHQRLSQR PQHLNHQKEKFEPQLLRFFHKNEIWYREQVRQKPDHQRLSQR NPLHRLEVEHRLHPVYPFDVDKSYDRLSYRLRLSPQP NPLHRLEVEHRLHPVYPFDVDKSYDRLSYRLRLSPQP WSEYRNVEQRNWLHFRNPDNDIRPWFVLNRDRLSWEYDLQQPQ WSEYRNVEQRNWLHFRNPDNDIRPWFVLNRDRLSWEYDLQQPQ PPPVSPRLHVPLMPQPPPKPQPRPPQSQPLPKREQPPSLRNPLS PPPVSPRLHVPLMPQPPPKPQPRPPQSQPLPKREQPPSLRNPLS QRLRKSLSSMRVVLVLRHPYILYWHSFSLIPWVLHLQDRPP QRLRKSLSSMRVVLVLRHPYILYWHSFSLIPWVLHLQDRPP EDLVVLQERRNHSEPQLVRSYRLHEFSPVSYQHDLLLRLQEDDSLLSP EDLVVLQERRNHSEPQLVRSYRLHEFSPVSYQHDLLLRLQEDDSLLSP YVQPVLPSRPSELQVWHQFEEEYSFLQEQVPFLSLERSPDVHS YVQPVLPSRPSELQVWHQFEEEYSFLQEQVPFLSLERSPDVHS SILPMLFLEDQDSPLVEDQERRLLQIISWSDRNKPVY SILPMLFLEDQDSPLVEDQERRLLQIISWSDRNKPVY DVYYLWIREHVS DVYYLWIREHVS P00740 P00748 ExPasy Dopasowanie optymalne i suboptymalne lalign Wykład 5,

11 oraz dopasowania 2 i 3: SIM P00740 P00748 Wykład 5,

12 Wartości substytucji i kary za przerwy schemat wartościowania I: (match) dopasowany: +1 (mismatch) niedopasowany: -1 (gap) przerwa: -1 (nie-afiniczne kary za przerwy każda przerwa traktowana jest tak samo) schemat wartościowania II: dopasowany: +1 niedopasowany: -1 otwarcie przerwy: przedłużenie przerwy: L (afiniczne kary za przerwy kara za otwarcie, kary za przedłużenie ) Punktacja obszar dopasowania - dopasowanie przerwa niedopasowanie S punktacja za dopasowanie Score = Max(S) S = Σ(dopasowania) - Σ(niedopasowania) - Σ(przerwy) Wykład 5,

13 Punktowanie przerw non-affine model (nieafinicznie): równo (match:4, mismatch:-3, gap:-4) affine model (afinicznie): + L n (match:4, mismatch:-3, gap creation:-8, gap:-4) : : : : Programowanie dynamiczne najlepsza ścieżka schemat wartościowania I: (match) dopasowany: +1 (mismatch) niedopasowany: -1 (gap) przerwa: -1 (nie-afiniczne kary za przerwy każda przerwa traktowana jest tak samo) Wykład 5,

14 Programowanie dynamiczne zasady: dopasowane z = -1 dopasowane z = +1 NULL dopasowane z = -1 dopasowane z NULL = -1 Programowanie dynamiczne Wykład 5,

15 Programowanie dynamiczne stopniowe poszerzanie ścieżek Programowanie dynamiczne stopniowe poszerzanie ścieżek Wykład 5,

16 Programowanie dynamiczne stopniowe poszerzanie ścieżek Programowanie dynamiczne stopniowe poszerzanie ścieżek Wykład 5,

17 Programowanie dynamiczne stopniowe poszerzanie ścieżek wszystkie punkty musza zostać zbadane Programowanie dynamiczne stopniowe poszerzanie ścieżek Wykład 5,

18 Programowanie dynamiczne stopniowe poszerzanie ścieżek - Programowanie dynamiczne stopniowe poszerzanie ścieżek - Wykład 5,

19 Wartości substytucji i kary za przerwy Schemat punktacji bardziej złożony: macierze substytucji PM: macierze oparte na modelu ewolucyjnym akceptowanych mutacji punktowych (1 jednostka PM- stopień zróznicowania ewolucyjnego, w którym zmienił się 1% aminokwasów) częstość zmian przypadkowych częstość tła częstość substytucji częstość docelowa zmiany pojawiające się w białkach spokrewnionych Macierz PM250 wartości w macierzy są proporcjonalne do logarytmu z (cz. docelowej/cz.tła) zbudowana na podstawie analizy par blisko spokrewnionych (1PM) i ekstrapolowana do 250PM ekstrapolacje można przeprowadzić dla różnych odległości ewolucyjnych PM duże PM stosuje się do porównywania sekwencji o dużym stopniu dywergencji ewolucyjnej małe PM do badania sekwencji podobnych Wykład 5,

20 Macierze BLOSUM Powstały w oparciu o bazę BLOKS dopasowanie sekwencji daleko spokrewnionych (oszacowanie częstotliwości docelowych, bez modelu ewolucyjnego) Rodzina macierzy: różnice (indeksu) związane są z maksymalnym stopniem identyczności sekwencji wziętych do obliczeń () BLOSUM62 BLOSUM90 do analizy sekwencji blisko spokrewnionych BOLSUM30 do analizy odległych ewolucyjnie sekwencji Wykład 5,

21 Statystyczne znaczenie dopasowań jaka jest wartość/ istotność dopasowania? Dla dopasowań globalnych: porównanie obliczonej wartości dla danego dopasowania z wartościami obliczonymi dla wielu dopasowań przypadkowych sekwencji o podobnym składzie i długości Dla dopasowań lokalnych: podstawą jest rozkład wartości granicznej, scharakteryzowanej paramerami K i λ E (S) = K m n exp -λs Expected value, wartość oczekiwana sekwencji mających wartość sonajmniej S S bit score, punktacja podobieństwa m range of alignment, długość porównywanego segmentu n wielkość bazy λ - określa wpływ systemu punktowania K liczba powtarzających się segmentów w przeszukiwanej sekwencji Wykład 5,

22 Następny wykład BLS, FS porównanie wielosekwencyjne w poszukiwanie wspólnego przodka KONIE Wykład 5,

Bioinformatyka. Podsumowanie algorytmów dynamicznych

Bioinformatyka. Podsumowanie algorytmów dynamicznych Bioinformatyka Wykład 5 E. Banachowicz Zakład Biofizyki Molekularnej IF UAM http://www.amu.edu.pl/~ewas Podsumowanie algorytmów dynamicznych Algorytmy porównywania sekwencji oparte na programowaniu dynamicznym

Bardziej szczegółowo

Przyrównanie sekwencji. Magda Mielczarek Katedra Genetyki Uniwersytet Przyrodniczy we Wrocławiu

Przyrównanie sekwencji. Magda Mielczarek Katedra Genetyki Uniwersytet Przyrodniczy we Wrocławiu Przyrównanie sekwencji Magda Mielczarek Katedra Genetyki Uniwersytet Przyrodniczy we Wrocławiu Sequence alignment - przyrównanie sekwencji Poszukiwanie ciągów znaków (zasad nukleotydowych lub reszt aminokwasowych),

Bardziej szczegółowo

Spis treści 8 Ewolucja molekularna... 87. 9 Ewolucyjne podstawy porównywania sekwencji... 87. 9.1 Identyfikacja sekwencji i jej funkcji...

Spis treści 8 Ewolucja molekularna... 87. 9 Ewolucyjne podstawy porównywania sekwencji... 87. 9.1 Identyfikacja sekwencji i jej funkcji... Spis treści 8 Ewolucja molekularna... 87 9 Ewolucyjne podstawy porównywania sekwencji... 87 9.1 Identyfikacja sekwencji i jej funkcji... 87 9.2 Homologia... 88 9.3 Modele ewolucji sekwencji białkowej...

Bardziej szczegółowo

Spis treści. Przedmowa... XI. Wprowadzenie i biologiczne bazy danych. 1 Wprowadzenie... 3. 2 Wprowadzenie do biologicznych baz danych...

Spis treści. Przedmowa... XI. Wprowadzenie i biologiczne bazy danych. 1 Wprowadzenie... 3. 2 Wprowadzenie do biologicznych baz danych... Przedmowa... XI Część pierwsza Wprowadzenie i biologiczne bazy danych 1 Wprowadzenie... 3 Czym jest bioinformatyka?... 5 Cele... 5 Zakres zainteresowań... 6 Zastosowania... 7 Ograniczenia... 8 Przyszłe

Bardziej szczegółowo

Przyrównywanie sekwencji

Przyrównywanie sekwencji Instytut Informatyki i Matematyki Komputerowej UJ, opracowanie: mgr Ewa Matczyńska, dr Jacek Śmietański Przyrównywanie sekwencji 1. Porównywanie sekwencji wprowadzenie Sekwencje porównujemy po to, aby

Bardziej szczegółowo

Wykład 10 2008-04-30. Bioinformatyka. Wykład 9. E. Banachowicz. Zakład Biofizyki Molekularnej IF UAM

Wykład 10 2008-04-30. Bioinformatyka. Wykład 9. E. Banachowicz. Zakład Biofizyki Molekularnej IF UAM Bioinformatyka Wykład 9 E. Banachowicz Zakład Biofizyki Molekularnej IF UAM http://www.amu.edu.pl/~ewas 1 Konsekwencje zestawieo wielu sekwencji - rodziny białkowe, domeny, motywy i wzorce 2 Bioinformatyka,

Bardziej szczegółowo

Porównywanie i dopasowywanie sekwencji

Porównywanie i dopasowywanie sekwencji Porównywanie i dopasowywanie sekwencji Związek bioinformatyki z ewolucją Wraz ze wzrostem dostępności sekwencji DNA i białek narodziła się nowa dyscyplina nauki ewolucja molekularna Ewolucja molekularna

Bardziej szczegółowo

PODSTAWY BIOINFORMATYKI 8 DOPASOWYWANIE SEKWENCJI AMINOKWASÓW

PODSTAWY BIOINFORMATYKI 8 DOPASOWYWANIE SEKWENCJI AMINOKWASÓW PODSTAWY BIOINFORMATYKI 8 DOPASOWYWANIE SEKWENCJI AMINOKWASÓW DOPASOWYWANIE SEKWENCJI 1. Miary podobieństwa sekwencji aminokwasów 2. Zastosowanie programów: CLUSTAL OMEGA BLAST Copyright 2013, Joanna Szyda

Bardziej szczegółowo

dopasowanie sekwencji Porównywanie sekwencji Etapy dopasowywania sekwencji Homologia, podobieństwo i analogia

dopasowanie sekwencji Porównywanie sekwencji Etapy dopasowywania sekwencji Homologia, podobieństwo i analogia Porównywanie sekwencji Homologia, podobieństwo i analogia dopasowanie sekwencji Dopasowanie/porównywanie Uliniowienie Alignment W bioinformatyce, dopasowanie sekwencji jest sposobem dopasowania struktur

Bardziej szczegółowo

Generator testów 1.3.1 Bioinformatyka_zdalne wer. 1.0.13 / 0 Strona: 1

Generator testów 1.3.1 Bioinformatyka_zdalne wer. 1.0.13 / 0 Strona: 1 Przedmiot: Bioinformatyka Nazwa testu: Bioinformatyka_zdalne wer. 1.0.13 Nr testu 0 Klasa: WNB UZ Odpowiedzi zaznaczamy TYLKO w tabeli! 1. Model Markowa substytucji aminokwasów w mutagenezie białek zakłada...

Bardziej szczegółowo

Motywy i podobieństwo

Motywy i podobieństwo Motywy i podobieństwo Całość funkcja Modularna budowa białek Elementy składowe czyli miejsca wiązania, domeny 1 Motywy Motyw jest opisem określonej części trójwymiarowej struktury zawierającym charakterystyczny

Bardziej szczegółowo

Generator testów Bioinformatyka wer / 0 Strona: 1

Generator testów Bioinformatyka wer / 0 Strona: 1 Przedmiot: Nazwa przedmiotu Nazwa testu: Bioinformatyka wer. 1.0.6 Nr testu 0 Klasa: V zaoczne WNB UZ Odpowiedzi zaznaczamy TYLKO w tabeli! 1. Analiza porównawcza białek zwykle zaczyna się na badaniach

Bardziej szczegółowo

Bioinformatyka 2 (BT172) Progresywne metody wyznaczania MSA: T-coffee

Bioinformatyka 2 (BT172) Progresywne metody wyznaczania MSA: T-coffee Bioinformatyka 2 (BT172) Wykład 5 Progresywne metody wyznaczania MSA: T-coffee Krzysztof Murzyn 14.XI.2005 PLAN WYKŁADU Ostatnio : definicje, zastosowania MSA, złożoność obliczeniowa algorytmu wyznaczania

Bardziej szczegółowo

Dopasowanie sekwencji c.d. Sequence alignment. Bioinformatyka, wykład 5 (16.XI.2010) krzysztof_pawlowski@sggw.pl

Dopasowanie sekwencji c.d. Sequence alignment. Bioinformatyka, wykład 5 (16.XI.2010) krzysztof_pawlowski@sggw.pl Dopasowanie sekwencji c.d. Sequence alignment Bioinformatyka, wykład 5 (16.XI.2010) krzysztof_pawlowski@sggw.pl dopasowanie - metody dopasowanie par sekwencji: Macierz punktów - dot matrix, dotplot Programowanie

Bardziej szczegółowo

Dopasowanie sekwencji c.d. Sequence alignment. Bioinformatyka, wykład 5 (6.XI.2012) krzysztof_pawlowski@sggw.pl

Dopasowanie sekwencji c.d. Sequence alignment. Bioinformatyka, wykład 5 (6.XI.2012) krzysztof_pawlowski@sggw.pl Dopasowanie sekwencji c.d. Sequence alignment Bioinformatyka, wykład 5 (6.XI.2012) krzysztof_pawlowski@sggw.pl Dopasowanie sekwencji - znaczenie Podobieństwo porównywanych sekwencji (similarity) może świadczyć

Bardziej szczegółowo

Genomika Porównawcza. Agnieszka Rakowska Instytut Informatyki i Matematyki Komputerowej Uniwersytet Jagiellooski

Genomika Porównawcza. Agnieszka Rakowska Instytut Informatyki i Matematyki Komputerowej Uniwersytet Jagiellooski Genomika Porównawcza Agnieszka Rakowska Instytut Informatyki i Matematyki Komputerowej Uniwersytet Jagiellooski 1 Plan prezentacji 1. Rodzaje i budowa drzew filogenetycznych 2. Metody ukorzeniania drzewa

Bardziej szczegółowo

Wykład Bioinformatyka 2012-09-24. Bioinformatyka. Wykład 7. E. Banachowicz. Zakład Biofizyki Molekularnej IF UAM. Ewolucyjne podstawy Bioinformatyki

Wykład Bioinformatyka 2012-09-24. Bioinformatyka. Wykład 7. E. Banachowicz. Zakład Biofizyki Molekularnej IF UAM. Ewolucyjne podstawy Bioinformatyki Bioinformatyka Wykład 7 E. Banachowicz Zakład Biofizyki Molekularnej IF UAM http://www.amu.edu.pl/~ewas 1 Plan Bioinformatyka Ewolucyjne podstawy Bioinformatyki Filogenetyka Bioinformatyczne narzędzia

Bardziej szczegółowo

Algorytmy kombinatoryczne w bioinformatyce

Algorytmy kombinatoryczne w bioinformatyce lgorytmy kombinatoryczne w bioinformatyce wykład 4: dopasowanie sekwencj poszukiwanie motywów prof. dr hab. inż. Marta Kasprzak Instytut Informatyk Politechnika Poznańska Dopasowanie sekwencji Badanie

Bardziej szczegółowo

MultiSETTER: web server for multiple RNA structure comparison. Sandra Sobierajska Uniwersytet Jagielloński

MultiSETTER: web server for multiple RNA structure comparison. Sandra Sobierajska Uniwersytet Jagielloński MultiSETTER: web server for multiple RNA structure comparison Sandra Sobierajska Uniwersytet Jagielloński Wprowadzenie Budowa RNA: - struktura pierwszorzędowa sekwencja nukleotydów w łańcuchu: A, U, G,

Bardziej szczegółowo

Księgarnia PWN: A.D. Baxevanis, B.F.F. Ouellette Bioinformatyka

Księgarnia PWN: A.D. Baxevanis, B.F.F. Ouellette Bioinformatyka Księgarnia PWN: A.D. Baxevanis, B.F.F. Ouellette Bioinformatyka Słowo wstępne XIII Przedmowa XV 1. Bioinformatyka i Internet Andreas D. Baxevanis 1 1.1. Podstawy Internetu 2 1.2. Połączenie z Internetem

Bardziej szczegółowo

Statystyczna analiza danych

Statystyczna analiza danych Statystyczna analiza danych ukryte modele Markowa, zastosowania Anna Gambin Instytut Informatyki Uniwersytet Warszawski plan na dziś Ukryte modele Markowa w praktyce modelowania rodzin białek multiuliniowienia

Bardziej szczegółowo

Bioinformatyka 2 (BT172) Struktura i organizacja kursu

Bioinformatyka 2 (BT172) Struktura i organizacja kursu Bioinformatyka 2 (BT172) Wykład 1 Struktura i organizacja kursu dr Krzysztof Murzyn adiunkt w Zakładzie Biofizyki WBtUJ pok. B028, tel. 664-6379 10.X.2005 PODSTAWOWE INFORMACJE 9 godz. wykładów (45 min,

Bardziej szczegółowo

Bioinformatyka wykład 3.I.2008

Bioinformatyka wykład 3.I.2008 Bioinformatyka wykład 3.I.2008 Białkowa bioinformatyka strukturalna c.d. krzysztof_pawlowski@sggw.pl 2008-01-03 1 Plan wykładu analiza i porównywanie struktur białek. doświadczalne metody badania struktur

Bardziej szczegółowo

Generator testów bioinformatyka wer / Strona: 1

Generator testów bioinformatyka wer / Strona: 1 Przedmiot: wyklad monograficzny Nazwa testu: bioinformatyka wer. 1.0.6 Nr testu 10469906 Klasa: 5 IBOS Odpowiedzi zaznaczamy TYLKO w tabeli! 1. Aminokwas jest to związek organiczny zawierający A) grupę

Bardziej szczegółowo

MSA i analizy filogenetyczne

MSA i analizy filogenetyczne Instytut Informatyki i Matematyki Komputerowej UJ, opracowanie: mgr Ewa Matczyńska, dr Jacek Śmietański MSA i analizy filogenetyczne 1. Dopasowania wielosekwencyjne - wprowadzenie Dopasowanie wielosekwencyjne

Bardziej szczegółowo

BIOLOGICZNE BAZY DANYCH SYLABUS

BIOLOGICZNE BAZY DANYCH SYLABUS BIOLOGICZNE BAZY DANYCH SYLABUS Elementy składowe sylabusu Nazwa jednostki prowadzącej kierunek Nazwa kierunku studiów Poziom kształcenia Profil studiów Forma studiów Kod Język Rodzaj Rok studiów /semestr

Bardziej szczegółowo

Księgarnia PWN: Paul G. Higgs, Teresa K. Attwood - Bioinformatyka i ewolucja molekularna

Księgarnia PWN: Paul G. Higgs, Teresa K. Attwood - Bioinformatyka i ewolucja molekularna Księgarnia PWN: Paul G. Higgs, Teresa K. Attwood - Bioinformatyka i ewolucja molekularna Przedmowa...................................................... 1 1. Rewolucja informatyczna w naukach biomedycznych...........................

Bardziej szczegółowo

Metody przeszukiwania

Metody przeszukiwania Metody przeszukiwania Co to jest przeszukiwanie Przeszukiwanie polega na odnajdywaniu rozwiązania w dyskretnej przestrzeni rozwiązao. Zwykle przeszukiwanie polega na znalezieniu określonego rozwiązania

Bardziej szczegółowo

2014-03-26. Analiza sekwencji promotorów

2014-03-26. Analiza sekwencji promotorów 2014-03-26 Analiza sekwencji promotorów 1 2014-03-26 TFy tworzą zawiły układ regulacyjny, na który składają się różne oddziaływania białko białko poprzez wytworzenie PĘTLI Specyficzne TFy Ogólne TFy Benfey,

Bardziej szczegółowo

Wstęp do programowania

Wstęp do programowania Wstęp do programowania Algorytmy zachłanne, programowanie dynamiczne Paweł Daniluk Wydział Fizyki Jesień 2014 P. Daniluk(Wydział Fizyki) WP w. IX Jesień 2014 1 / 26 Algorytmy zachłanne Strategia polegająca

Bardziej szczegółowo

WIZUALIZACJA ALGORYTMÓW OPTYMALNEGO DOPASOWANIA SEKWENCJI NUKLEOTYDÓW I AMINOKWASÓW

WIZUALIZACJA ALGORYTMÓW OPTYMALNEGO DOPASOWANIA SEKWENCJI NUKLEOTYDÓW I AMINOKWASÓW STUDIA INFORMATICA 2011 Volume 32 Number 2A (96) Adam SKOWRON, Dariusz MROZEK Politechnika Śląska, Instytut Informatyki WIZUALIZACJA ALGORYTMÓW OPTYMALNEGO DOPASOWANIA SEKWENCJI NUKLEOTYDÓW I AMINOKWASÓW

Bardziej szczegółowo

Podstawy bioinformatyki dla biotechnologów

Podstawy bioinformatyki dla biotechnologów dla biotechnologów Wykład 3 alignment Wykład 2 Porównywanie sekwencji Homologia, podobieństwo i analogia Wykład 2; slajd 2 Duplikacja, specjacja Wykład 2; slajd 3 Homologi Ortologi homologiczne geny, których

Bardziej szczegółowo

Acknowledgement. Drzewa filogenetyczne

Acknowledgement. Drzewa filogenetyczne Wykład 8 Drzewa Filogenetyczne Lokalizacja genów Some figures from: Acknowledgement M. Zvelebil, J.O. Baum, Introduction to Bioinformatics, Garland Science 2008 Tradycyjne drzewa pokrewieństwa Drzewa oparte

Bardziej szczegółowo

Heurystyki. Strategie poszukiwań

Heurystyki. Strategie poszukiwań Sztuczna inteligencja Heurystyki. Strategie poszukiwań Jacek Bartman Zakład Elektrotechniki i Informatyki Instytut Techniki Uniwersytet Rzeszowski DLACZEGO METODY PRZESZUKIWANIA? Sztuczna Inteligencja

Bardziej szczegółowo

Bioinformatyka II Modelowanie struktury białek

Bioinformatyka II Modelowanie struktury białek Bioinformatyka II Modelowanie struktury białek 1. Który spośród wymienionych szablonów wybierzesz do modelowania? Dlaczego? Struktura krystaliczną czy NMR (to samo białko, ta sama rozdzielczość)? Strukturę

Bardziej szczegółowo

Bioinformatyka. Bazy danych. Wykład 3. E. Banachowicz. Wykład monograficzny Bioinformatyka. Wykład 3, Zakład Biofizyki Molekularnej IF UAM

Bioinformatyka. Bazy danych. Wykład 3. E. Banachowicz. Wykład monograficzny Bioinformatyka. Wykład 3, Zakład Biofizyki Molekularnej IF UAM Bioinformatyka Wykład 3. E. Banachowicz Zakład Biofizyki Molekularnej IF UAM http://www.amu.edu.pl/~ewas Bazy danych Wykład 3, 2008 1 Niesekwencyjne BazyDanych bibliograficzne kliniczne ścieżek metabolicznych

Bardziej szczegółowo

FILOGENETYKA. Bioinformatyka, wykład. 8 c.d. 0)

FILOGENETYKA. Bioinformatyka, wykład. 8 c.d. 0) FILOGENETYKA Bioinformatyka, wykład 8 c.d. (7.XII.2010) 0) krzysztof_pawlowski@sggw.pl Filogenetyka Cel rekonstrukcja historii ewolucji wszystkich organizmów. Klasyczne podejście: historia ewolucji jest

Bardziej szczegółowo

PODSTAWY BIOINFORMATYKI

PODSTAWY BIOINFORMATYKI PODSTAWY BIOINFORMATYKI Prowadzący: JOANNA SZYDA ADRIAN DROśDś WSTĘP 1. Katedra Genetyki badania bioinformatyczne 2. Tematyka przedmiotu 3. Charakterystyka wykładów 4. Charakterystyka ćwiczeń 5. Informacje

Bardziej szczegółowo

Wstęp do programowania

Wstęp do programowania Wstęp do programowania Programowanie dynamiczne Paweł Daniluk Wydział Fizyki Jesień 2013 P. Daniluk(Wydział Fizyki) WP w. X Jesień 2013 1 / 21 Dziel i zwyciężaj przypomnienie 1 Podział problemu na 2 lub

Bardziej szczegółowo

Podobieństwo semantyczne w ontologiach biomedycznych

Podobieństwo semantyczne w ontologiach biomedycznych Podobieństwo semantyczne w ontologiach biomedycznych Bogumił Konopka Politechnika Wrocławska Wydział Podstawowych Problemów Techniki Instytut Inżynierii Biomedycznej i Pomiarowej KN Bio Nanopor Plan prezentacji

Bardziej szczegółowo

RMSD - Ocena jakości wybranych molekularnych struktur przestrzennych

RMSD - Ocena jakości wybranych molekularnych struktur przestrzennych RMSD - Ocena jakości wybranych molekularnych struktur przestrzennych Joanna Wiśniewska Promotor: dr inż. P. Łukasiak Spis treści 1. Zakres pracy magisterskiej 2. Struktura białka 3. Struktura kwasów nukleionowych

Bardziej szczegółowo

Wybrane podstawowe rodzaje algorytmów

Wybrane podstawowe rodzaje algorytmów Wybrane podstawowe rodzaje algorytmów Tomasz Głowacki tglowacki@cs.put.poznan.pl Zajęcia finansowane z projektu "Rozwój i doskonalenie kształcenia na Politechnice Poznańskiej w zakresie technologii informatycznych

Bardziej szczegółowo

Ćwiczenia nr 5. Wykorzystanie baz danych i narzędzi analitycznych dostępnych online

Ćwiczenia nr 5. Wykorzystanie baz danych i narzędzi analitycznych dostępnych online Techniki molekularne ćw. 5 1 z 13 Ćwiczenia nr 5. Wykorzystanie baz danych i narzędzi analitycznych dostępnych online I. Zasoby NCBI Strona: http://www.ncbi.nlm.nih.gov/ stanowi punkt startowy dla eksploracji

Bardziej szczegółowo

Działanie algorytmu oparte jest na minimalizacji funkcji celu jako suma funkcji kosztu ( ) oraz funkcji heurystycznej ( ).

Działanie algorytmu oparte jest na minimalizacji funkcji celu jako suma funkcji kosztu ( ) oraz funkcji heurystycznej ( ). Algorytm A* Opracowanie: Joanna Raczyńska 1.Wstęp Algorytm A* jest heurystycznym algorytmem służącym do znajdowania najkrótszej ścieżki w grafie. Jest to algorytm zupełny i optymalny, co oznacza, że zawsze

Bardziej szczegółowo

Spokrewnienie prawdopodobieństwo, że dwa losowe geny od dwóch osobników są genami IBD. IBD = identical by descent, geny identycznego pochodzenia

Spokrewnienie prawdopodobieństwo, że dwa losowe geny od dwóch osobników są genami IBD. IBD = identical by descent, geny identycznego pochodzenia prawdopodobieństwo, że dwa losowe geny od dwóch osobników są genami ID. Relationship Relatedness Kinship Fraternity ID = identical by descent, geny identycznego pochodzenia jest miarą względną. Przyjmuje

Bardziej szczegółowo

Mitochondrialna Ewa;

Mitochondrialna Ewa; Mitochondrialna Ewa; jej sprzymierzeńcy i wrogowie Lien Dybczyńska Zakład genetyki, Uniwersytet Warszawski 01.05.2004 Milion lat temu Ale co dalej??? I wtedy wkracza biologia molekularna Analiza różnic

Bardziej szczegółowo

Bioinformatyka II Modelowanie struktury białek

Bioinformatyka II Modelowanie struktury białek Bioinformatyka II Modelowanie struktury białek 1. Który spośród wymienionych szablonów wybierzesz do modelowania dla każdego z podanych przypadków? Dlaczego? Struktura krystaliczną czy NMR (to samo białko,

Bardziej szczegółowo

Wyszukiwanie podobnych sekwencji w bazach danych. Wyszukiwanie w sekwencji nukleotydów czy aminokwasów? Czułość i selektywność

Wyszukiwanie podobnych sekwencji w bazach danych. Wyszukiwanie w sekwencji nukleotydów czy aminokwasów? Czułość i selektywność Wersja 1.05 Wprowadzenie do Informatyki Biomedycznej Wykład 3: Wyszukiwanie w bazach sekwencji Przewidywanie genów Wydział Informatyki PB Marek Krętowski pokój 206 e-mail: m.kretowski@pb.edu.pl http://aragorn.pb.bialystok.pl/~mkret

Bardziej szczegółowo

Bioinformatyka wykład 10.I.2008

Bioinformatyka wykład 10.I.2008 Bioinformatyka wykład 10.I.2008 Przewidywanie struktur białek krzysztof_pawlowski@sggw.pl 2008-01-10 1 Plan wykładu pole siłowe - opis energetyczny struktur białka proces zwijania się białek przewidywanie

Bardziej szczegółowo

Definicja pliku kratowego

Definicja pliku kratowego Pliki kratowe Definicja pliku kratowego Plik kratowy (ang grid file) jest strukturą wspierająca realizację zapytań wielowymiarowych Uporządkowanie rekordów, zawierających dane wielowymiarowe w pliku kratowym,

Bardziej szczegółowo

Przewodnik do planowania programu kształcenia na II roku studiów I stopnia. Kierunek: Bioinformatyka. 17 czerwca 2013 r.

Przewodnik do planowania programu kształcenia na II roku studiów I stopnia. Kierunek: Bioinformatyka. 17 czerwca 2013 r. Przewodnik do planowania programu kształcenia na II roku studiów I stopnia Kierunek: Bioinformatyka Przeznaczony dla studentów, którzy w roku 2012/13 studiują na I roku studiów I stopnia 17 czerwca 2013

Bardziej szczegółowo

Bioinformatyka Laboratorium, 30h. Michał Bereta mbereta@pk.edu.pl www.michalbereta.pl

Bioinformatyka Laboratorium, 30h. Michał Bereta mbereta@pk.edu.pl www.michalbereta.pl Laboratorium, 30h Michał Bereta mbereta@pk.edu.pl www.michalbereta.pl Zasady zaliczenia przedmiotu Kolokwia (3 4 ) Ocena aktywności i przygotowania Obecnośd Literatura, materiały Bioinformatyka i ewolucja

Bardziej szczegółowo

S YL AB US MODUŁ U ( PRZEDMIOTU) I nforma cje ogólne. Podstawy genetyki w psychiatrii. 4 Wykłady 24 Ćwiczenia 10. Prof. Dr hab.

S YL AB US MODUŁ U ( PRZEDMIOTU) I nforma cje ogólne. Podstawy genetyki w psychiatrii. 4 Wykłady 24 Ćwiczenia 10. Prof. Dr hab. S YL AB US MODUŁ U ( PRZEDMIOTU) I nforma cje ogólne Kod modułu Rodzaj modułu Wydział PUM Kierunek studiów Specjalność Poziom studiów Forma studiów Rok studiów Nazwa modułu Podstawy genetyki w psychiatrii

Bardziej szczegółowo

ALGORYTMICZNA I STATYSTYCZNA ANALIZA DANYCH

ALGORYTMICZNA I STATYSTYCZNA ANALIZA DANYCH 1 ALGORYTMICZNA I STATYSTYCZNA ANALIZA DANYCH WFAiS UJ, Informatyka Stosowana II stopień studiów 2 Wnioskowanie statystyczne dla zmiennych numerycznych Porównywanie dwóch średnich Boot-strapping Analiza

Bardziej szczegółowo

SZTUCZNA INTELIGENCJA

SZTUCZNA INTELIGENCJA SZTUCZNA INTELIGENCJA WYKŁAD 13. PROBLEMY OPTYMALIZACYJNE Częstochowa 2014 Dr hab. inż. Grzegorz Dudek Wydział Elektryczny Politechnika Częstochowska PROBLEMY OPTYMALIZACYJNE Optymalizacja poszukiwanie

Bardziej szczegółowo

Scenariusz lekcji z biologii w szkole ponadgimnazjalnej

Scenariusz lekcji z biologii w szkole ponadgimnazjalnej Scenariusz lekcji z biologii w szkole ponadgimnazjalnej Temat lekcji: Planowanie doświadczeń biologicznych jak prawidłowo zaplanować próbę kontrolną? Cele kształcenia IV etap edukacyjny: 1. Wymagania ogólne:

Bardziej szczegółowo

Podstawy Sztucznej Inteligencji (PSZT)

Podstawy Sztucznej Inteligencji (PSZT) Podstawy Sztucznej Inteligencji (PSZT) Paweł Wawrzyński Przeszukiwanie Przeszukiwanie przestrzeni stanów Motywacja Rozwiązywanie problemów: poszukiwanie sekwencji operacji prowadzącej do celu poszukiwanie

Bardziej szczegółowo

Przewidywanie struktury kanału białkowego z wykorzystaniem probabilistycznych gramatyk formalnych oraz modelu ciągłego przepływu jonów

Przewidywanie struktury kanału białkowego z wykorzystaniem probabilistycznych gramatyk formalnych oraz modelu ciągłego przepływu jonów Przewidywanie struktury kanału białkowego z wykorzystaniem probabilistycznych gramatyk formalnych oraz modelu ciągłego przepływu jonów Witold Dyrka Instytut Inżynierii Biomedycznej i Pomiarowej, Politechnika

Bardziej szczegółowo

ALHE Z11 Jarosław Arabas wykład 11

ALHE Z11 Jarosław Arabas wykład 11 ALHE Z11 Jarosław Arabas wykład 11 algorytm ewolucyjny inicjuj P 0 {x 1, x 2... x } t 0 while! stop for i 1: if a p c O t,i mutation crossover select P t, k else O t,i mutation select P t,1 P t 1 replacement

Bardziej szczegółowo

Rycina 1. Zasięg i zagęszczenie łosi (liczba osobników/1000 ha) w Polsce w roku 2010 oraz rozmieszczenie 29 analizowanych populacji łosi.

Rycina 1. Zasięg i zagęszczenie łosi (liczba osobników/1000 ha) w Polsce w roku 2010 oraz rozmieszczenie 29 analizowanych populacji łosi. Ryciny 193 Rycina 1. Zasięg i zagęszczenie łosi (liczba osobników/1000 ha) w Polsce w roku 2010 oraz rozmieszczenie 29 analizowanych populacji łosi. Na fioletowo zaznaczone zostały populacje (nr 1 14)

Bardziej szczegółowo

Filogenetyka molekularna I. Krzysztof Spalik

Filogenetyka molekularna I. Krzysztof Spalik Filogenetyka molekularna I Krzysztof Spalik Literatura Krzysztof Spalik, Marcin Piwczyński (2009), Rekonstrukcja filogenezy i wnioskowanie filogenetyczne w badaniach ewolucyjnych, Kosmos 58(3-4): 485-498

Bardziej szczegółowo

Teoria ewolucji. Podstawowe pojęcia. Wspólne pochodzenie.

Teoria ewolucji. Podstawowe pojęcia. Wspólne pochodzenie. Teoria ewolucji Podstawowe pojęcia. Wspólne pochodzenie. Ewolucja Znaczenie ogólne: zmiany zachodzące stopniowo w czasie W biologii ewolucja biologiczna W astronomii i kosmologii ewolucja gwiazd i wszechświata

Bardziej szczegółowo

Algorytm Genetyczny. zastosowanie do procesów rozmieszczenia stacji raportujących w sieciach komórkowych

Algorytm Genetyczny. zastosowanie do procesów rozmieszczenia stacji raportujących w sieciach komórkowych Algorytm Genetyczny zastosowanie do procesów rozmieszczenia stacji raportujących w sieciach komórkowych Dlaczego Algorytmy Inspirowane Naturą? Rozwój nowych technologii: złożone problemy obliczeniowe w

Bardziej szczegółowo

FILOGENETYKA. Bioinformatyka, wykład 7 (24.XI.200..XI.2008)

FILOGENETYKA. Bioinformatyka, wykład 7 (24.XI.200..XI.2008) FILOGENETYKA Bioinformatyka, wykład 7 (24.XI.200.XI.2008) krzysztof_pawlowski@sggw.pl Filogenetyka Cel rekonstrukcja historii ewolucji wszystkich organizmów. Klasyczne podejście: historia ewolucji jest

Bardziej szczegółowo

LABORATORIUM 4: Algorytmy ewolucyjne cz. 2 wpływ operatorów krzyżowania i mutacji na skuteczność poszukiwań AE

LABORATORIUM 4: Algorytmy ewolucyjne cz. 2 wpływ operatorów krzyżowania i mutacji na skuteczność poszukiwań AE Instytut Mechaniki i Inżynierii Obliczeniowej Wydział Mechaniczny Technologiczny, Politechnika Śląska www.imio.polsl.pl METODY HEURYSTYCZNE LABORATORIUM 4: Algorytmy ewolucyjne cz. 2 wpływ operatorów krzyżowania

Bardziej szczegółowo

Analizy DNA in silico - czyli czego można szukać i co można znaleźć w sekwencjach nukleotydowych???

Analizy DNA in silico - czyli czego można szukać i co można znaleźć w sekwencjach nukleotydowych??? Analizy DNA in silico - czyli czego można szukać i co można znaleźć w sekwencjach nukleotydowych??? Alfabet kwasów nukleinowych jest stosunkowo ubogi!!! Dla sekwencji DNA (RNA) stosuje się zasadniczo*

Bardziej szczegółowo

Genetyka populacji. Ćwiczenia 7

Genetyka populacji. Ćwiczenia 7 Genetyka populacji Ćwiczenia 7 Rodowody wraz z wynikami kontroli użytkowości stanowią podstawową informację potrzebną do doskonalenia zwierząt C F X S D C F C F S D strzałka oznacza przepływ genów między

Bardziej szczegółowo

Bioinformatyczne bazy danych

Bioinformatyczne bazy danych Bioinformatyczne bazy danych Czym jest bioinformatyka? Bioinformatyka jest nauką integrującą różne dziedziny wiedzy Gruca (2010) Czym jest bioinformatyka? Bioinformatyka obejmuje technologie wykorzystujące

Bardziej szczegółowo

KORELACJE I REGRESJA LINIOWA

KORELACJE I REGRESJA LINIOWA KORELACJE I REGRESJA LINIOWA Korelacje i regresja liniowa Analiza korelacji: Badanie, czy pomiędzy dwoma zmiennymi istnieje zależność Obie analizy się wzajemnie przeplatają Analiza regresji: Opisanie modelem

Bardziej szczegółowo

Modelowanie hierarchicznych struktur w relacyjnych bazach danych

Modelowanie hierarchicznych struktur w relacyjnych bazach danych Modelowanie hierarchicznych struktur w relacyjnych bazach danych Wiktor Warmus (wiktorwarmus@gmail.com) Kamil Witecki (kamil@witecki.net.pl) 5 maja 2010 Motywacje Teoria relacyjnych baz danych Do czego

Bardziej szczegółowo

Obróbka po realnej powierzchni o Bez siatki trójkątów o Lepsza jakość po obróbce wykańczającej o Tylko jedna tolerancja jakości powierzchni

Obróbka po realnej powierzchni o Bez siatki trójkątów o Lepsza jakość po obróbce wykańczającej o Tylko jedna tolerancja jakości powierzchni TEBIS Wszechstronny o Duża elastyczność programowania o Wysoka interaktywność Delikatne ścieżki o Nie potrzebny dodatkowy moduł HSC o Mniejsze zużycie narzędzi o Mniejsze zużycie obrabiarki Zarządzanie

Bardziej szczegółowo

Algorytmy ewolucyjne NAZEWNICTWO

Algorytmy ewolucyjne NAZEWNICTWO Algorytmy ewolucyjne http://zajecia.jakubw.pl/nai NAZEWNICTWO Algorytmy ewolucyjne nazwa ogólna, obejmująca metody szczegółowe, jak np.: algorytmy genetyczne programowanie genetyczne strategie ewolucyjne

Bardziej szczegółowo

BUDOWA I FUNKCJA GENOMU LUDZKIEGO

BUDOWA I FUNKCJA GENOMU LUDZKIEGO BUDOWA I FUNKCJA GENOMU LUDZKIEGO Magdalena Mayer Katedra i Zakład Genetyki Medycznej UM w Poznaniu 1. Projekt poznania genomu człowieka: Cele programu: - skonstruowanie szczegółowych map fizycznych i

Bardziej szczegółowo

THE UNFOLDED PROTEIN RESPONSE

THE UNFOLDED PROTEIN RESPONSE THE UNFOLDED PROTEIN RESPONSE Anna Czarnecka Źródło: Intercellular signaling from the endoplasmatic reticulum to the nucleus: the unfolded protein response in yeast and mammals Ch. Patil & P. Walter The

Bardziej szczegółowo

Filogenetyka molekularna I. Krzysztof Spalik Zakład Filogenetyki Molekularnej i Ewolucji

Filogenetyka molekularna I. Krzysztof Spalik Zakład Filogenetyki Molekularnej i Ewolucji Filogenetyka molekularna I Krzysztof Spalik Zakład Filogenetyki Molekularnej i Ewolucji 3 Literatura Krzysztof Spalik, Marcin Piwczyński (2009), Rekonstrukcja filogenezy i wnioskowanie filogenetyczne w

Bardziej szczegółowo

Rynek Budowlany-J.Deszcz 2013-03-02

Rynek Budowlany-J.Deszcz 2013-03-02 Politechnika Śląska w Gliwicach Wydział Budownictwa Katedra Procesów Budowlanych Badania i analizy rynku w działalności przedsiębiorstwa budowlanego. Potrzeby badań rynku na etapie planowania biznesu Kim

Bardziej szczegółowo

Podstawy biologii. Informacja genetyczna. Co to jest ewolucja.

Podstawy biologii. Informacja genetyczna. Co to jest ewolucja. Podstawy biologii Informacja genetyczna. Co to jest ewolucja. Zarys biologii molekularnej genu Podstawowe procesy genetyczne Replikacja powielanie informacji Ekspresja wyrażanie (realizowanie funkcji)

Bardziej szczegółowo

Algorytmy genetyczne

Algorytmy genetyczne 9 listopada 2010 y ewolucyjne - zbiór metod optymalizacji inspirowanych analogiami biologicznymi (ewolucja naturalna). Pojęcia odwzorowujące naturalne zjawiska: Osobnik Populacja Genotyp Fenotyp Gen Chromosom

Bardziej szczegółowo

BIOINFORMATYKA BIOLOGICZNE BAZY DANYCH

BIOINFORMATYKA BIOLOGICZNE BAZY DANYCH http://theta.edu.pl/ Podstawy Bioinformatyki II BIOINFORMATYKA BIOLOGICZNE BAZY DANYCH 1 Czym jest bioinformatyka? 2 Bioinformatyka Bioinformatyka jest interdyscyplinarną dziedziną nauki obejmującą wykorzystanie

Bardziej szczegółowo

EGZAMIN MAGISTERSKI, Biomatematyka

EGZAMIN MAGISTERSKI, Biomatematyka Biomatematyka 90...... Zadanie 1. (8 punktów) Załóżmy, że w diploidalnej populacji, dla której zachodzi prawo Hardy ego- Weinberga dla loci o dwóch allelach A i a proporcja osobników o genotypie AA wynosi

Bardziej szczegółowo

Obliczenia ewolucyjne - plan wykładu

Obliczenia ewolucyjne - plan wykładu Obliczenia ewolucyjne - plan wykładu Wprowadzenie Algorytmy genetyczne Programowanie genetyczne Programowanie ewolucyjne Strategie ewolucyjne Inne modele obliczeń ewolucyjnych Podsumowanie Ewolucja Ewolucja

Bardziej szczegółowo

Customer Attribution Models. czyli o wykorzystaniu machine learning w domu mediowym.

Customer Attribution Models. czyli o wykorzystaniu machine learning w domu mediowym. Customer Attribution Models czyli o wykorzystaniu machine learning w domu mediowym. Proces decyzyjny MAILING SEO SEM DISPLAY RETARGETING PRZEGRANI??? ZWYCIĘZCA!!! Modelowanie atrybucja > Słowo klucz: wpływ

Bardziej szczegółowo

Urszula Poziomek, doradca metodyczny w zakresie biologii Materiał dydaktyczny przygotowany na konferencję z cyklu Na miarę Nobla, 14 stycznia 2010 r.

Urszula Poziomek, doradca metodyczny w zakresie biologii Materiał dydaktyczny przygotowany na konferencję z cyklu Na miarę Nobla, 14 stycznia 2010 r. Ćwiczenie 1 1 Wstęp Rozważając możliwe powiązania filogenetyczne gatunków, systematyka porównuje dane molekularne. Najskuteczniejszym sposobem badania i weryfikacji różnych hipotez filogenetycznych jest

Bardziej szczegółowo

Wstęp do sieci neuronowych, wykład 12 Łańcuchy Markowa

Wstęp do sieci neuronowych, wykład 12 Łańcuchy Markowa Wstęp do sieci neuronowych, wykład 12 Łańcuchy Markowa M. Czoków, J. Piersa 2012-01-10 1 Łańcucha Markowa 2 Istnienie Szukanie stanu stacjonarnego 3 1 Łańcucha Markowa 2 Istnienie Szukanie stanu stacjonarnego

Bardziej szczegółowo

Ewolucja molekularna człowieka okiem bioinformatyka. Justyna Wojtczak Jarosław Jeleniewicz

Ewolucja molekularna człowieka okiem bioinformatyka. Justyna Wojtczak Jarosław Jeleniewicz Ewolucja molekularna człowieka okiem bioinformatyka Justyna Wojtczak Jarosław Jeleniewicz Informatyka w biologii - bioinformatyka Jest to szeroka dziedzina zajmująca się tworzeniem zaawansowanych baz danych,

Bardziej szczegółowo

Historia informacji genetycznej. Jak ewolucja tworzy nową informację (z ma ą dygresją).

Historia informacji genetycznej. Jak ewolucja tworzy nową informację (z ma ą dygresją). Historia informacji genetycznej. Jak ewolucja tworzy nową informację (z ma ą dygresją). Czym jest życie? metabolizm + informacja (replikacja) 2 Cząsteczki organiczne mog y powstać w atmosferze pierwotnej

Bardziej szczegółowo

Algorytmy przeszukiwania wzorca

Algorytmy przeszukiwania wzorca Algorytmy i struktury danych Instytut Sterowania i Systemów Informatycznych Wydział Elektrotechniki, Informatyki i Telekomunikacji Uniwersytet Zielonogórski Algorytmy przeszukiwania wzorca 1 Wstęp Algorytmy

Bardziej szczegółowo

MODELE LINIOWE. Dr Wioleta Drobik

MODELE LINIOWE. Dr Wioleta Drobik MODELE LINIOWE Dr Wioleta Drobik MODELE LINIOWE Jedna z najstarszych i najpopularniejszych metod modelowania Zależność między zbiorem zmiennych objaśniających, a zmienną ilościową nazywaną zmienną objaśnianą

Bardziej szczegółowo

ALGORYTMY EWOLUCYJNE W OPTYMALIZACJI JEDNOKRYTERIALNEJ

ALGORYTMY EWOLUCYJNE W OPTYMALIZACJI JEDNOKRYTERIALNEJ ALGORYTMY EWOLUCYJNE W OPTYMALIZACJI JEDNOKRYTERIALNEJ Zalety: nie wprowadzają żadnych ograniczeń na sformułowanie problemu optymalizacyjnego. Funkcja celu może być wielowartościowa i nieciągła, obszar

Bardziej szczegółowo

Algorytmy ewolucyjne optymalizacji wielokryterialnej sterowane preferencjami decydenta

Algorytmy ewolucyjne optymalizacji wielokryterialnej sterowane preferencjami decydenta Algorytmy ewolucyjne optymalizacji wielokryterialnej sterowane preferencjami decydenta Dr Janusz Miroforidis MGI Metro Group Information Technology Polska Sp. z o.o. listopad 2010 Wprowadzenie Plan prezentacji

Bardziej szczegółowo

Rodziny - narzędzie dynamicznej analizy projektów

Rodziny - narzędzie dynamicznej analizy projektów Rodziny Narzędzie dynamicznej analizy Stanisław Gasik Sybena Consulting www.sybena.pl Software Project Management GigaCon, Warszawa, 23.09.2009 Portfele Zbiór, programów i innych prac, połączonych żeby

Bardziej szczegółowo

9. Metody dydaktyczne 10. Podstawowe informacje i zaliczone kursy z genetyki i biologii molekularnej oraz dobra znajom angielskiego.

9. Metody dydaktyczne 10. Podstawowe informacje i zaliczone kursy z genetyki i biologii molekularnej oraz dobra znajom angielskiego. Lp. Opis sylabusu 1. Nazwa przedmiotu Bioinformatyka i genomika 3. Kod przedmiotu BioGenom1 5. - - 6. Typ przedmiotu 7. Rok studiów, semestr Studia II stopnia, semestr I 8. 9. Metody dydaktyczne 10. Podstawowe

Bardziej szczegółowo

"Zapisane w genach, czyli Python a tajemnice naszego genomu."

Zapisane w genach, czyli Python a tajemnice naszego genomu. "Zapisane w genach, czyli Python a tajemnice naszego genomu." Dr Kaja Milanowska Instytut Biologii Molekularnej i Biotechnologii UAM VitaInSilica sp. z o.o. Warszawa, 9 lutego 2015 Dane biomedyczne 1)

Bardziej szczegółowo

Metody Optymalizacji: Przeszukiwanie z listą tabu

Metody Optymalizacji: Przeszukiwanie z listą tabu Metody Optymalizacji: Przeszukiwanie z listą tabu Wojciech Kotłowski Instytut Informatyki Politechniki Poznańskiej email: imię.nazwisko@cs.put.poznan.pl pok. 2 (CW) tel. (61)665-2936 konsultacje: wtorek

Bardziej szczegółowo

Przewidywanie struktury białek: od modelowania opartego o szablony. do rekombinacji fragmentów metodą dr Frankensteina

Przewidywanie struktury białek: od modelowania opartego o szablony. do rekombinacji fragmentów metodą dr Frankensteina Przewidywanie struktury białek: od modelowania opartego o szablony do rekombinacji fragmentów metodą dr Frankensteina Iwona A. Cymerman, Joanna M. Sasin, Janusz M. Bujnicki Pracownia Bioinformatyki i Inżynierii

Bardziej szczegółowo

Rok akademicki: 2013/2014 Kod: ZIE n Punkty ECTS: 6. Poziom studiów: Studia I stopnia Forma i tryb studiów: -

Rok akademicki: 2013/2014 Kod: ZIE n Punkty ECTS: 6. Poziom studiów: Studia I stopnia Forma i tryb studiów: - Nazwa modułu: Statystyka opisowa i ekonomiczna Rok akademicki: 2013/2014 Kod: ZIE-1-205-n Punkty ECTS: 6 Wydział: Zarządzania Kierunek: Informatyka i Ekonometria Specjalność: - Poziom studiów: Studia I

Bardziej szczegółowo

Wybrane techniki badania białek -proteomika funkcjonalna

Wybrane techniki badania białek -proteomika funkcjonalna Wybrane techniki badania białek -proteomika funkcjonalna Proteomika: umożliwia badanie zestawu wszystkich (lub prawie wszystkich) białek komórkowych Zalety analizy proteomu w porównaniu z analizą trankryptomu:

Bardziej szczegółowo

Co to jest transkryptom? A. Świercz ANALIZA DANYCH WYSOKOPRZEPUSTOWYCH 2

Co to jest transkryptom? A. Świercz ANALIZA DANYCH WYSOKOPRZEPUSTOWYCH 2 ALEKSANDRA ŚWIERCZ Co to jest transkryptom? A. Świercz ANALIZA DANYCH WYSOKOPRZEPUSTOWYCH 2 Ekspresja genów http://genome.wellcome.ac.uk/doc_wtd020757.html A. Świercz ANALIZA DANYCH WYSOKOPRZEPUSTOWYCH

Bardziej szczegółowo

Podstawy biologiczne - komórki. Podstawy biologiczne - cząsteczki. Model komórki eukariotycznej. Wprowadzenie do Informatyki Biomedycznej

Podstawy biologiczne - komórki. Podstawy biologiczne - cząsteczki. Model komórki eukariotycznej. Wprowadzenie do Informatyki Biomedycznej Wprowadzenie do Informatyki Biomedycznej Wykład 1: Podstawy bioinformatyki Wydział Informatyki PB Podstawy biologiczne - komórki Wszystkie organizmy zbudowane są z komórek komórka jest skomplikowanym systemem

Bardziej szczegółowo

Algorytm genetyczny (genetic algorithm)-

Algorytm genetyczny (genetic algorithm)- Optymalizacja W praktyce inżynierskiej często zachodzi potrzeba znalezienia parametrów, dla których system/urządzenie będzie działać w sposób optymalny. Klasyczne podejście do optymalizacji: sformułowanie

Bardziej szczegółowo