Selen, Se ŚLESIN. Toksyczność. Se Konieczność. Niedobór

Wielkość: px
Rozpocząć pokaz od strony:

Download "Selen, Se ŚLESIN. Toksyczność. Se 78.96. Konieczność. Niedobór"

Transkrypt

1 Opracowanie metod analitycznych przeznaczonych do charakterystyki dodatków żywnościowych i pasz przygotowanych na bazie drożdży wzbogaconych w selen 2006 dr inż. Aleksandra Polatajko

2 Selen, Se Toksyczność Konieczność Niedobór µg/dzień Se

3 Znaczenie biologiczne selenu 3 dla zdrowia człowieka zmniejsza ryzyko chorób nowotworowych, serca i układu krążenia wzmacnia sprawność układu odpornościowego zwiększa płodność oraz zapobiega poronieniom chroni przed przedwczesnym starzeniem zmniejsza ryzyko depresji poprawia wygląd skóry, włosów i paznokci...i zwierząt stymuluje właściwy wzrost wzmacnia sprawność układu odpornościowego zwiększa płodność u samic pomaga utrzymać świeżość produktów mięsnych dodaje mięsu soczystości i smaku polepsza kolor i teksturę mięsa zwiększa sprawność koni wyścigowych

4 Źródła selenu Człowiek Żywność bogata w selen Parafarmaceutyki na bazie drożdży wzbogaconych w selen Zwierzęta Dodatki paszowe na bazie drożdży wzbogaconych w selen µg /dzień mg /kg paszy

5 5 Dzienne zapotrzebowanie i aktualne spożycie selenu w wybranych państwach Kraj Australia Belgia Francja Japonia Kanada Niemcy Nowa Zelandia Polska Szwecja Szwajcaria Wielka Brytania USA Zalecane dzienne dawki spożycia Se µg/dzień Mężczyźni Kobiety Aktualne spożycie Se (teoretyczne)

6 Zawartości selenu w wybranych produktach żywnościowych 6 Produkt Orzechy brazylijskie Pszenica Tuńczyk w konserwie Prażone nasiona słonecznika Watroba drobiowa Maka pszenna Chude mieso i drób Czosnek Zawartośc selenu µg w 100g do 3000 ok

7 Zalecana forma selenu-l-selenomethionina CH 3 S CH 2 Se CH 3 Se CH 2 CH 2 + H 3 N C COO H CH 2 + H 3 N C COO H Methionina (Met) M Selenomethionina (SeMet) 7

8 Opracowanie metod analitycznych do charakterystyki drożdży selenowych i produktów pochodnych Frakcjonowanie i analiza specjacyjna selenu w drożdżach i paszach wzbogaconych w selen Analiza ilościowa selenometioniny, badanie jej stabilności i procesów utleniania Walidacja opracowanych metod analitycznych Systematyczna charakterystyka związków selenu obecnych w drożdżach wzbogaconych w selen Porównanie profili chromatograficznych (ang. fingerprinting) jako metoda określania źródeł pochodzenia produktów handlowych 8 Zaproponowanie metody ilościowego oznaczania białek zawierających selen

9 Stosowane techniki analityczne Przygotowanie próbki do analizy specjacyjnej 1. metody ekstrakcji nienaruszające struktury chemicznej związków 2. kontrolowana degradacja np. enzymatyczna Techniki sprzężone (SEC, AE, RP) 9 ICP MS Wysokosprawna chromatografia cieczowa ES MS/MS MALDI TOFMS

10 Frakcjonowanie związków selenu w drożdżach wzbogaconych w selen Wydajność ekstrakcji 100% 80% 60% 40% 20% 0% A B C D E F G H Próbki różnego pochodzenia Pozostałość Białka nierozpuszczalne w wodzie Związki selenu pozostające w strukturze ścian komórkowych Związki selenu rozpuszczalne w wodzie: selen nieorganiczny, selenoaminokwasy, niektóre proteiny zawierające selen 10 Ekstrakcja wodna Rozkład mieszaniną enzymów pektynolitycznych Ekstrakcja za pomocą SDS Rozkład kwasem azotowym

11 11 Analiza specjacyjna selenu w drożdżach i paszach wzbogaconych w selen Warunki 8 0.2g drożdży + roztwór chromatograficzne- AE proteazy Eluenty: A: 20 mm kwas octowy, 10 mm trietyloamina B: 200 mm kwas octowy, 100 mm trietyloamina Gradient: 0 5 min: 0 100% A wirowanie 5 30 min: 0 100% B10 min, 2500 rpm min: 100% B Przeplyw fazy ruchomej: 1.5 ml/min przesącz Granice wykrywalności: SeMet: 1-2 ng/g Se(IV)/Se(VI): Analiza 50 ng/gae HPLC-ICP MS 82 Se Intensywność x 10 4, cps mieszanie, 17h w 37 C 82 Se Intensywność x 10 3, cps 4 osad Czas, min SeMetO SeMet Wydajność ekstrakcji 93±4% Se SeMet 75±4 % Se(IV) x 2 Se(VI)

12 12 82 Se Intensywność x 10 4, cps Zastosowanie chromatografii dwuwymiarowej AE - SEC - ICP MS Chromatografia anionowymienna SeMetO SeMet I II III Czas, min Se Intensywność x 10 3, cps Frakcja I Frakcja II Frakcja III Czas elucji, min Chromatografia wykluczania SeMet+SeMetO 54 % 98 % 39 % SeMet SeMetO Se 7.1 ± 0.2 % 67 ± 1 % 26 ± 1 %

13 Walidacja opracowanych metod analitycznych metodą rozcieńczeń izotopowych (ang. Isotopic Dilution Analysis) Oznaczanie całkowitej zawartości Se niespecyficzny dodatek wzorca znakowanego izotopowo - Se 76 Oznaczanie SeMet specyficzny dodatek wzorca znakowanego izotopowo - SeMet 77 próbka Metoda dodatku wzorca wewn IDA ( 80 Se/ 76 Se) próbka Metoda dodatku wzorca wewn IDA ( 80 Se/ 77 Se) mg/kg mg/kg mg/kg mg/kg ± ± ± ± ± ± ± ± ± ± ± ±

14 Walidacja opracowanych metod analitycznych - udział w badaniach międzylaboratoryjnych Analizowana próbka: Drożdże wzbogacone w selen Oznaczanie całkowitej zawartości Se Oznaczanie SeMet 14 Całkowita zawartość Se x 10 3, mg/kg x numer laboratorium x x Stężenie selenometiony x 10 3, mg/kg numer laboratorium

15 15 Systematyczna charakterystyka związków selenu w drożdżach osad Próbka drożdży Próbka drożdży osad osad Ekstrakcja SDS przesącz Ekstrakcja wodna przesącz Frakcjonowanie przy użyciu SEC Ekstrakcja Driselasą przesącz Oczyszczanie frakcji charakterystyka charakterystyka przy przy użyciu użyciu SEC-ICP SEC-ICP MS, MS, RP RP HPLC-ICP HPLC-ICP MS, MS, ESI ESI MS/MS MS/MS rozkład trypsyną charakterystyka charakterystyka przy przy użyciu użyciu SEC-ICP SEC-ICP MS, MS, RP RP HPLC-ICP HPLC-ICP MS MS Frakcjonowanie przy użyciu RP HPLC rozkład proteazą charakterystyka charakterystyka przy przy użyciu użyciu MALDI MALDI TOF TOF MS, MS, ESI ESI MS/MS MS/MS charakterystyka charakterystyka przy przy użyciu użyciu SEC-ICP SEC-ICP MS, MS, RP RP HPLC-ICP HPLC-ICP MS MS charakterystyka charakterystyka przy przy użyciu użyciu SEC-ICP SEC-ICP MS MS

16 Se 3 Se Intensywność x ,, cps cps Charakterystyka wodnego ekstraktu drożdzy selenowych RP- ICP MS SEC-ICP MS 82 Se Intensywność x 10 4, cps Wielkocząsteczkowe frakcje Małocząsteczkowe frakcje Objętość elucji, ml ES TOF ES MS/MS ES TOF TOF MS/MS Baza danych MS/MS Baza danych 2 & & & 2 MALDI TOF MALDI MALDI MSTOF TOF MS MS HSP12 SIP18 Heat Salt Induced Shock Protein Czas, min

17 Opracowanie metody określania źródła pochodzenia produktów handlowych Przygotowanie próbki Stosowana aparatura drożdże mikroprzeplywowa HPLC pompa 106 µl min µl min -1 ekstrakcja wodna podzielnik przepływu fazy ruchomej rozkład enzymatyczny trypsyną dozownik kolumna kapilarna Kalibrator 4 µl min-1 przedkolumna komora mgielna 17 Analiza kapilara RP HPLC ICP MS ICP palnik mikronebulizer

18 18 80 Se Intensywność x 10 3, cps 80 Se Intensywność x 10 3, cps Porównanie profili chromatograficznych próbek produktów handlowych (ang. fingerprinting) Podobne profile chromatograficzne Czas, min 3 80 Se Intensywność x 10 3, cps 80 Se Intensywność x 10 4, cps Różne profile chromatograficzne Czas, min

19 Zastosowanie HPLC ICP MS do analizy ilościowej białek zawierających selen HSP12 (Heat-Shock Protein) SEKWENCJA AMINOKWASÓW MSDAGRKGFGEKASEALKPDSQKSYAEQGKEYIT- DKADKVAGKVQPEDNKGVFQGVHDSAEKGKDNAE- GQGESLADQAR- D Y M G A A K -SKLND AVEYVSGRVHGEEDPTKK 19 peptyd DYMGAAK (Asp-Tyr-Met-Gly-Ala-Ala-Lys) powstający po rozkładzie trypsyną białka HSP12 i jest dla niego charakterystyczny hydroliza enzymatyczna trypsyną białka HSP12 jest ilościowa izotopowo znakowany peptyd może być otrzymany przez: syntezę oczyszczenie z ekstraktu enzymatycznego izotopowo znakowanych drożdży

20 Przygotowanie izotopowo znakowanego ( 77 Se) wzorca Izotopowo ( 77 Se) znakowane drożdże ekstrakcja wodna wirowanie Frakcjonowanie przy użyciu SEC-ICP MS rozkład przy użyciu trypsyny wirowanie Frakcjonowanie przy użyciu RP-ICP MS 77 Se Intensywność x10 3, cps Se Intensywność x 10 3, cps Asp-Tyr-SeMet-Gly-Ala-Ala-Lys Numer frakcji Numer frakcji

21 Sprawdzenie czystości wyizolowanego peptydu Kapilarna RP HPLC ICP MS z komora zderzeniową 21 Intensywność x10 4, cps C Se =2.04 ± 0.02 µg Se g -1 C peptydu =24.5 ± 0.2 nmol g % Czas, min 82 Se 80 Se 77 Se 40

22 Analiza ilościowa metodą rozcieńczeń izotopowych-kapilarna RP HPLC-ICP MS Intensywność x10 3, cps Se 80 Se Próbka z dodatkiem znakowanego peptydu 77 Se/ 80 Se Stosunek izotopowy C Se = 66 ± 3 µg Se g -1 C peptydu = 0.84 ± 0.04 nmol g -1 C proteiny = 21.7 ± 1.1 nmol g Czas, min

23 Wnioski Opracowano i zwalidowano metody oznaczania całkowitej zawartości selenu i selenometioniny w drożdżach i paszach wzbogaconych w selen- niezbędne do kontroli jakości tych produktów Wykazano, iż 80% selenu w próbkach drożdży występuje w postaci selenometioniny, a cześć z niej jest niespecyficznie związana ze składnikami matrycy Przedstawiono pełną charakterystykę ilościową i jakościową związków selenu obecnych w drożdżach wzbogaconych w selen Opracowano metodę określania źródeł pochodzenia produktów handlowych (ang. fingerprinting) 23 Zaproponowano metodę ilościowej analizy białek zawierających selen metodą rozcieńczeń izotopowych z zastosowaniem kapilarnej RP HPLC ICP MS z komorą zderzeniową

24 Dziękuje za uwagę! 2006 dr inż. Aleksandra Polatajko

Zapytanie ofertowe nr 1/2014 ( dotyczy zamówienia badań )

Zapytanie ofertowe nr 1/2014 ( dotyczy zamówienia badań ) Zdrochem Sp. z o.o. Warszawa, 27 stycznia 2014 r. tel. +48 223900990, 609 019 283 fax. +48 223507490 info@zdrochem.pl www.zdrochem.pl I. ZAMAWIAJĄCY Zdrochem Sp. z o.o. NIP: 7010333468 REGON: 145983792

Bardziej szczegółowo

Jakość wyników specjacyjnego oznaczania pierwiastków techniką HPLC-ICP-MS

Jakość wyników specjacyjnego oznaczania pierwiastków techniką HPLC-ICP-MS Jakość wyników specjacyjnego oznaczania pierwiastków techniką HPLC-ICP-MS Danuta Barałkiewicz, Izabela Komorowicz, Barbara Pikosz, Magdalena Belter Pracownia Analizy Spektroskopowej Pierwiastków Wydział

Bardziej szczegółowo

Instrukcja do ćwiczeń laboratoryjnych

Instrukcja do ćwiczeń laboratoryjnych UNIWERSYTET GDAŃSKI WYDZIAŁ CHEMII Pracownia studencka Katedra Analizy Środowiska Instrukcja do ćwiczeń laboratoryjnych Ćwiczenie nr 2 OPTYMALIZACJA ROZDZIELANIA MIESZANINY WYBRANYCH FARMACEUTYKÓW METODĄ

Bardziej szczegółowo

Pytania z Wysokosprawnej chromatografii cieczowej

Pytania z Wysokosprawnej chromatografii cieczowej Pytania z Wysokosprawnej chromatografii cieczowej 1. Jak wpłynie 50% dodatek MeOH do wody na retencję kwasu propionowego w układzie faz odwróconych? 2. Jaka jest kolejność retencji kwasów mrówkowego, octowego

Bardziej szczegółowo

Chemia kryminalistyczna

Chemia kryminalistyczna Chemia kryminalistyczna Wykład 2 Metody fizykochemiczne 21.10.2014 Pytania i pomiary wykrycie obecności substancji wykazanie braku substancji identyfikacja substancji określenie stężenia substancji określenie

Bardziej szczegółowo

OFERTA TEMATÓW PROJEKTÓW DYPLOMOWYCH (MAGISTERSKICH) do zrealizowania w Katedrze INŻYNIERII CHEMICZNEJ I PROCESOWEJ

OFERTA TEMATÓW PROJEKTÓW DYPLOMOWYCH (MAGISTERSKICH) do zrealizowania w Katedrze INŻYNIERII CHEMICZNEJ I PROCESOWEJ OFERTA TEMATÓW PROJEKTÓW DYPLOMOWYCH (MAGISTERSKICH) do zrealizowania w Katedrze INŻYNIERII CHEMICZNEJ I PROCESOWEJ Badania kinetyki utleniania wybranych grup związków organicznych podczas procesów oczyszczania

Bardziej szczegółowo

Instrukcja ćwiczenia laboratoryjnego HPLC-2 Nowoczesne techniki analityczne

Instrukcja ćwiczenia laboratoryjnego HPLC-2 Nowoczesne techniki analityczne Instrukcja ćwiczenia laboratoryjnego HPLC-2 Nowoczesne techniki analityczne 1) OZNACZANIE ROZKŁADU MASY CZĄSTECZKOWEJ POLIMERÓW Z ASTOSOWANIEM CHROMATOGRAFII ŻELOWEJ; 2) PRZYGOTOWANIE PRÓBKI Z ZASTOSOWANIEM

Bardziej szczegółowo

ZASTOSOWANIE WYSOKOSPRAWNEJ CHROMATOGRAFII CIECZOWEJ DO OZNACZANIA BENZOESANU SODU W PRODUKTACH SPOŻYWCZYCH

ZASTOSOWANIE WYSOKOSPRAWNEJ CHROMATOGRAFII CIECZOWEJ DO OZNACZANIA BENZOESANU SODU W PRODUKTACH SPOŻYWCZYCH ZASTOSOWANIE WYSOKOSPRAWNEJ CHROMATOGRAFII CIECZOWEJ DO OZNACZANIA BENZOESANU SODU W PRODUKTACH SPOŻYWCZYCH Instrukcja do ćwiczeń opracowana w Katedrze Chemii Środowiska Uniwersytetu Łódzkiego. 1. Wstęp

Bardziej szczegółowo

e) nasiona słonecznika; śruta poekstrakcyjna słonecznikowa; śruta poekstrakcyjna słonecznikowa z częściowo obłuszczonych nasion słonecznika;

e) nasiona słonecznika; śruta poekstrakcyjna słonecznikowa; śruta poekstrakcyjna słonecznikowa z częściowo obłuszczonych nasion słonecznika; 12.2.2008 Dziennik Urzędowy Unii Europejskiej L 37/3 ROZPORZĄDZENIE KOMISJI (WE) NR 121/2008 z dnia 11 lutego 2008 r. określające metodę analizy do oznaczania zawartości skrobi w preparatach w rodzaju

Bardziej szczegółowo

Tabela potwierdzenia informacji rejestracyjnych przedsiębiorstwa produkcji importowanego mleka pasteryzowanego

Tabela potwierdzenia informacji rejestracyjnych przedsiębiorstwa produkcji importowanego mleka pasteryzowanego Tabela potwierdzenia informacji rejestracyjnych przedsiębiorstwa produkcji importowanego mleka pasteryzowanego 1. Podstawowe informacje na temat przedsiębiorstwa (wypełnia przedsiębiorstwo ubiegające się)

Bardziej szczegółowo

OD HPLC do UPLC. Prof. dr hab. inż. Agata Kot-Wasik. Katedra Chemii Analitycznej Wydział Chemiczny, Politechnika Gdańska

OD HPLC do UPLC. Prof. dr hab. inż. Agata Kot-Wasik. Katedra Chemii Analitycznej Wydział Chemiczny, Politechnika Gdańska OD HPLC do UPLC Katedra Chemii Analitycznej Wydział Chemiczny, Politechnika Gdańska 1 PREHISTORIA 1966 Chromatogram autorstwa L.R.Snyder Analiza chinolin LC-GC North America, 30(4), 328-341, 2012 2 PREHISTORIA

Bardziej szczegółowo

GraŜyna Chwatko Zakład Chemii Środowiska

GraŜyna Chwatko Zakład Chemii Środowiska Chromatografia podstawa metod analizy laboratoryjnej GraŜyna Chwatko Zakład Chemii Środowiska Chromatografia gr. chromatos = barwa grapho = pisze Michaił Siemionowicz Cwiet 2 Chromatografia jest metodą

Bardziej szczegółowo

Instrukcja do ćwiczeń laboratoryjnych

Instrukcja do ćwiczeń laboratoryjnych UNIWERSYTET GDAŃSKI Pracownia studencka Zakład Analizy Środowiska Instrukcja do ćwiczeń laboratoryjnych Ćwiczenie nr 3 Oznaczanie witaminy E w oleju metodą HPLC ANALIZA PRODUKTÓW POCHODZENIA NATURALNEGO

Bardziej szczegółowo

Materiał obowiązujący do ćwiczeń z analizy instrumentalnej II rok OAM

Materiał obowiązujący do ćwiczeń z analizy instrumentalnej II rok OAM Materiał obowiązujący do ćwiczeń z analizy instrumentalnej II rok OAM Ćwiczenie 1 Zastosowanie statystyki do oceny metod ilościowych Błąd gruby, systematyczny, przypadkowy, dokładność, precyzja, przedział

Bardziej szczegółowo

Cz. 5. Podstawy instrumentalizacji chromatografii. aparatura chromatograficzna w skali analitycznej i modelowej - -- w części przypomnienie -

Cz. 5. Podstawy instrumentalizacji chromatografii. aparatura chromatograficzna w skali analitycznej i modelowej - -- w części przypomnienie - Chromatografia cieczowa jako technika analityki, przygotowania próbek, wsadów do rozdzielania, technika otrzymywania grup i czystych substancji Cz. 5. Podstawy instrumentalizacji chromatografii aparatura

Bardziej szczegółowo

SPIS TREŚCI. 1. Znaczenie nauki o żywieniu. 2. Gospodarka energetyczna organizmu człowieka. 3. Podstawowe składniki pokarmowe i ich rola

SPIS TREŚCI. 1. Znaczenie nauki o żywieniu. 2. Gospodarka energetyczna organizmu człowieka. 3. Podstawowe składniki pokarmowe i ich rola 3 SPIS TREŚCI 1. Znaczenie nauki o żywieniu 1.1. Cele i zadania nauki o żywieniu................................................8 1.2. Rozwój nauki o żywieniu człowieka.............................................9

Bardziej szczegółowo

Ekstrakt z Chińskich Daktyli

Ekstrakt z Chińskich Daktyli Ekstrakt z Chińskich Daktyli Ekstrakt z Chińskich Daktyli TIENS Lekarze z Chin uważają, że owoce głożyny znane jako chińskie daktyle Pomagają zachować sprawność Poprawiają odporność Wspomagają pracę żołądka

Bardziej szczegółowo

Bezinwazyjne badania specjacji

Bezinwazyjne badania specjacji Uniwersytet Warszawski Wydział Chemii Bezinwazyjne badania specjacji prof. dr hab. Ewa Bulska rok akademicki 214 / 215 Przykład I Korozja atramentowa atramenty żelazowo-galusowe w zabytkach rękopiśmiennych

Bardziej szczegółowo

Spis treści. Aparatura

Spis treści. Aparatura Spis treści Aparatura I. Podstawowe wyposażenie laboratoryjne... 13 I.I. Probówki i naczynia laboratoryjne... 13 I.II. Pipety... 17 I.II.I. Rodzaje pipet automatycznych... 17 I.II.II. Techniki pipetowania...

Bardziej szczegółowo

EquiPower Reiskeimöl Olej z zarodków ryżu

EquiPower Reiskeimöl Olej z zarodków ryżu EquiPower Reiskeimöl Olej z zarodków ryżu o trzykierunkowym działaniu 1) Wzmacnia budowę mięśni 2) Poprawia siłę mięśniową 3) Stabilizuje przemianę energii i materii bez obciążania białkiem Składniki analityczne:

Bardziej szczegółowo

TaqNova-RED. Polimeraza DNA RP20R, RP100R

TaqNova-RED. Polimeraza DNA RP20R, RP100R TaqNova-RED Polimeraza DNA RP20R, RP100R RP20R, RP100R TaqNova-RED Polimeraza DNA Rekombinowana termostabilna polimeraza DNA Taq zawierająca czerwony barwnik, izolowana z Thermus aquaticus, o przybliżonej

Bardziej szczegółowo

Dziennik Urzędowy Unii Europejskiej

Dziennik Urzędowy Unii Europejskiej L 174/8 PL 3.7.2015 ROZPORZĄDZENIE WYKONAWCZE KOMISJI (UE) 2015/1061 z dnia 2 lipca 2015 r. dotyczące na stosowanie kwasu askorbinowego, soli sodowej fosforanu askorbylu, soli sodowo-wapniowej fosforanu

Bardziej szczegółowo

TaqNovaHS. Polimeraza DNA RP902A, RP905A, RP910A, RP925A RP902, RP905, RP910, RP925

TaqNovaHS. Polimeraza DNA RP902A, RP905A, RP910A, RP925A RP902, RP905, RP910, RP925 TaqNovaHS RP902A, RP905A, RP910A, RP925A RP902, RP905, RP910, RP925 RP902A, RP905A, RP910A, RP925A RP902, RP905, RP910, RP925 TaqNovaHS Polimeraza TaqNovaHS jest mieszaniną termostabilnej polimerazy DNA

Bardziej szczegółowo

Laboratorium Utylizacji Odpadów (Laboratorium Badawcze Biologiczno Chemiczne)

Laboratorium Utylizacji Odpadów (Laboratorium Badawcze Biologiczno Chemiczne) Laboratorium Utylizacji Odpadów (Laboratorium Badawcze Biologiczno Chemiczne) mgr inż. Maria Sadowska mgr Katarzyna Furmanek mgr inż. Marcin Młodawski Laboratorium prowadzi prace badawcze w zakresie: Utylizacji

Bardziej szczegółowo

CHOLESTONE NATURALNA OCHRONA PRZED MIAŻDŻYCĄ. www.california-fitness.pl www.calivita.com

CHOLESTONE NATURALNA OCHRONA PRZED MIAŻDŻYCĄ. www.california-fitness.pl www.calivita.com CHOLESTONE NATURALNA OCHRONA PRZED MIAŻDŻYCĄ Co to jest cholesterol? Nierozpuszczalna w wodzie substancja, która: jest składnikiem strukturalnym wszystkich błon komórkowych i śródkomórkowych wchodzi w

Bardziej szczegółowo

Interdyscyplinarny charakter badań równoważności biologicznej produktów leczniczych

Interdyscyplinarny charakter badań równoważności biologicznej produktów leczniczych Interdyscyplinarny charakter badań równoważności biologicznej produktów leczniczych Piotr Rudzki Zakład Farmakologii, w Warszawie Kongres Świata Przemysłu Farmaceutycznego Łódź, 25 VI 2009 r. Prace badawczo-wdrożeniowe

Bardziej szczegółowo

PRODUKTY PLUS FIRMY TIENS

PRODUKTY PLUS FIRMY TIENS PRODUKTY PLUS FIRMY TIENS PRODUKTY PLUS FIRMY TIENS TIENS POLSKA PRZEDSTAWIA NOWĄ SERIĘ PRODUKTÓW PLUS 5000 lat chińskiej tradycji i wiedzy połączone z najnowszą technologią z Europy PRODUTY PLUS FIRMY

Bardziej szczegółowo

Nowoczesne metody analizy pierwiastków

Nowoczesne metody analizy pierwiastków Nowoczesne metody analizy pierwiastków Techniki analityczne Chromatograficzne Spektroskopowe Chromatografia jonowa Emisyjne Absorpcyjne Fluoroscencyjne Spektroskopia mas FAES ICP-AES AAS EDAX ICP-MS Prezentowane

Bardziej szczegółowo

BIOTECHNOLOGIA W KOSMETOLOGII SŁAWOMIR WIERZBA

BIOTECHNOLOGIA W KOSMETOLOGII SŁAWOMIR WIERZBA BIOTECHNOLOGIA W KOSMETOLOGII SŁAWOMIR WIERZBA TREŚĆ WYKŁADÓW Budowa i biologia skóry. Typy skóry. Funkcje skóry. Układ odpornościowy skóry. Starzenie się skóry. Przenikanie przez skórę. Absorpcja skórna.

Bardziej szczegółowo

Wymagania dotyczące badania czynników chemicznych w środowisku pracy w normach europejskich. dr Marek Dobecki - IMP Łódź

Wymagania dotyczące badania czynników chemicznych w środowisku pracy w normach europejskich. dr Marek Dobecki - IMP Łódź Wymagania dotyczące badania czynników chemicznych w środowisku pracy w normach europejskich dr Marek Dobecki - IMP Łódź 1 DOSTĘPNE NORMY EUROPEJSKIE: BADANIA POWIETRZA NA STANOWISKACH PRACY PN-EN 689:2002

Bardziej szczegółowo

Produkcja biomasy. Termin BIOMASA MIKROORGANIZMÓW oznacza substancję komórek wytwarzaną w wyniku masowej hodowli drobnoustrojów.

Produkcja biomasy. Termin BIOMASA MIKROORGANIZMÓW oznacza substancję komórek wytwarzaną w wyniku masowej hodowli drobnoustrojów. Termin BIOMASA MIKROORGANIZMÓW oznacza substancję komórek wytwarzaną w wyniku masowej hodowli drobnoustrojów. BIAŁKO JEDNOKOMÓRKOWCÓW (SCP single cell protein) biomasa mikroorganizmów stosowana jako źródło

Bardziej szczegółowo

CHARAKTERYSTYKA PRODUKTU LECZNICZEGO 2. SKŁAD JAKOŚCIOWY I ILOŚCIOWY SUBSTANCJI CZYNNYCH

CHARAKTERYSTYKA PRODUKTU LECZNICZEGO 2. SKŁAD JAKOŚCIOWY I ILOŚCIOWY SUBSTANCJI CZYNNYCH CHARAKTERYSTYKA PRODUKTU LECZNICZEGO 1. NAZWA WŁASNA PRODUKTU LECZNICZEGO SOLUVIT N, proszek do sporządzania roztworu do infuzji 2. SKŁAD JAKOŚCIOWY I ILOŚCIOWY SUBSTANCJI CZYNNYCH 1 fiolka zawiera: Substancje

Bardziej szczegółowo

Biznes Mixer w ramach Forum Inicjowania Rozwoju 2014

Biznes Mixer w ramach Forum Inicjowania Rozwoju 2014 Biznes Mixer w ramach Forum Inicjowania Rozwoju 2014 Oferta rozwiązań naukowych dla biznesu i innych partnerów InnoDoktorant, VI edycja Magdalena Śliwińska prof. dr hab. inż. Waldemar Wardencki dr. inż.

Bardziej szczegółowo

WALIDACJA PROCESU MYCIA

WALIDACJA PROCESU MYCIA WALIDACJA PROCESU MYCIA Cleaning Validation Practices Using a One-Pot Processor Pharmaceutical Technology Europe February 2004 Barbara Budnik Maria Pulpińska One-Pot Processor mieszanie granulacja suszenie

Bardziej szczegółowo

PathogenFree DNA Isolation Kit Zestaw do izolacji DNA Instrukcja użytkownika

PathogenFree DNA Isolation Kit Zestaw do izolacji DNA Instrukcja użytkownika PathogenFree DNA Isolation Kit Zestaw do izolacji DNA Instrukcja użytkownika Spis treści 1. Zawartość 2 1.1 Składniki zestawu 2 2. Opis produktu 2 2.1 Założenia metody 2 2.2 Instrukcja 2 2.3 Specyfikacja

Bardziej szczegółowo

RSM+S z Puław NAWÓZ XXI WIEKU

RSM+S z Puław NAWÓZ XXI WIEKU RSM+S z Puław NAWÓZ XXI WIEKU Puławy 2012 Zasobność gleb w siarkę Prawie 60% gleb w Polsce jest ubogich w siarkę. Niedobór siarki ogranicza zawartość i jakość białka i tłuszczu, ogranicza gromadzenie się

Bardziej szczegółowo

Deproteinizacja jako niezbędny etap przygotowania próbek biologicznych

Deproteinizacja jako niezbędny etap przygotowania próbek biologicznych Deproteinizacja jako niezbędny etap przygotowania próbek biologicznych Instrukcja do ćwiczeń opracowana w Katedrze Chemii Środowiska Uniwersytetu Łódzkiego. 1. Wstęp Określenie próbka biologiczna jest

Bardziej szczegółowo

NARZĘDZIA DO KONTROLI I ZAPEWNIENIA JAKOŚCI WYNIKÓW ANALITYCZNYCH. Piotr KONIECZKA

NARZĘDZIA DO KONTROLI I ZAPEWNIENIA JAKOŚCI WYNIKÓW ANALITYCZNYCH. Piotr KONIECZKA 1 NARZĘDZIA DO KONTROLI I ZAPEWNIENIA JAKOŚCI WYNIKÓW ANALITYCZNYCH Piotr KONIECZKA Katedra Chemii Analitycznej Wydział Chemiczny Politechnika Gdańska ul. G. Narutowicza 11/12 80-952 GDAŃSK e-mail: kaczor@chem.pg.gda.pl

Bardziej szczegółowo

ZASTOSOWANIE CHROMATOGRAFII CIECZOWEJ W BIOTECHNOLOGII ŚRODOWISKOWEJ

ZASTOSOWANIE CHROMATOGRAFII CIECZOWEJ W BIOTECHNOLOGII ŚRODOWISKOWEJ Wstęp: ZASTOSOWANIE CHROMATOGRAFII CIECZOWEJ W BIOTECHNOLOGII ŚRODOWISKOWEJ Chromatografią cieczową nazywamy chromatografię, w której eluentem jest ciecz, zwykle rozpuszczalnik organiczny. HPLC (ang. High

Bardziej szczegółowo

Nowoczesne techniki analityczne w analizie specjacyjnej arsenu i chromu w próbkach środowiskowych Danuta Barałkiewicz Izabela Komorowicz, Karol Sęk

Nowoczesne techniki analityczne w analizie specjacyjnej arsenu i chromu w próbkach środowiskowych Danuta Barałkiewicz Izabela Komorowicz, Karol Sęk Nowoczesne techniki analityczne w analizie specjacyjnej arsenu i chromu w próbkach środowiskowych Danuta Barałkiewicz Izabela Komorowicz, Karol Sęk Pracownia Analizy Spektroskopowej Pierwiastków Wydział

Bardziej szczegółowo

Przedmiot zamówienia na dostawę karmy dla psów i kotów, mieszanek nasiennych, pasz granulowanych, gammarusa i pęczków ulistnionych gałęzi do

Przedmiot zamówienia na dostawę karmy dla psów i kotów, mieszanek nasiennych, pasz granulowanych, gammarusa i pęczków ulistnionych gałęzi do Przedmiot zamówienia na dostawę karmy dla psów i kotów, mieszanek nasiennych, pasz granulowanych, gammarusa i pęczków ulistnionych gałęzi do Miejskiego Ogrodu Zoologicznego Wybrzeża w Gdańsku. 1 ZADANIE

Bardziej szczegółowo

Część I Zakup zestawów diagnostycznych do GMO.

Część I Zakup zestawów diagnostycznych do GMO. Załącznik 4a Część I Zakup zestawów diagnostycznych do GMO. NAZWA WIELKOŚC OPAKNIA RAZEM WARTOŚĆ 1 2 3 4 5 6 7 8=4*7 9 10 11 1. Zestaw do izolacji DNA - zestaw służący do izolacji DNA z surowego materiału

Bardziej szczegółowo

MIĘSO, WĘDLINY, RYBY, JAJKA I NASIONA ROŚLIN STRĄCZKOWYCH W DIECIE DZIECKA

MIĘSO, WĘDLINY, RYBY, JAJKA I NASIONA ROŚLIN STRĄCZKOWYCH W DIECIE DZIECKA MIĘSO, WĘDLINY, RYBY, JAJKA I NASIONA ROŚLIN STRĄCZKOWYCH W DIECIE DZIECKA Wartość odżywcza Żywność z tej grupy należy do grupy produktów białkowych. Białko mięsa, ryb i jaj charakteryzuje sie dużą wartością

Bardziej szczegółowo

Bioterra zdrowie i uroda. Rodzice marzą o tym, aby ich dzieci były zdrowe. Dorosłe dzieci dbają o zdrowie rodziców. Zakochani o kochanych.

Bioterra zdrowie i uroda. Rodzice marzą o tym, aby ich dzieci były zdrowe. Dorosłe dzieci dbają o zdrowie rodziców. Zakochani o kochanych. Bioterra zdrowie i uroda Rodzice marzą o tym, aby ich dzieci były zdrowe. Dorosłe dzieci dbają o zdrowie rodziców. Zakochani o kochanych. Każdy człowiek marzy o zdrowiu i urodzie. Pragnienie to nie zależy

Bardziej szczegółowo

Część I Zakup zestawów diagnostycznych do GMO.

Część I Zakup zestawów diagnostycznych do GMO. Załącznik 4a Część I Zakup zestawów diagnostycznych do GMO. NAZWA WIELKOŚC OPAKOWANIA JEDNOSTK OWA VAT % RAZEM WARTOŚĆ 1 2 3 4 5 6 7 8=4*7 9 10 11 1. Zestaw do izolacji DNA - zestaw służący do izolacji

Bardziej szczegółowo

Jakościowe i ilościowe oznaczanie alkoholi techniką chromatografii gazowej

Jakościowe i ilościowe oznaczanie alkoholi techniką chromatografii gazowej Jakościowe i ilościowe oznaczanie alkoholi techniką chromatografii gazowej Instrukcja do ćwiczeń opracowana w Katedrze Chemii Środowiska Uniwersytetu Łódzkiego. 1. Wstęp teoretyczny Zagadnienie rozdzielania

Bardziej szczegółowo

Zasady zdrowego żywienia i aktywności fizycznej młodzieży

Zasady zdrowego żywienia i aktywności fizycznej młodzieży Zasady zdrowego żywienia i aktywności fizycznej młodzieży Pamiętaj o codziennym spożywaniu produktów zawartych w piramidzie! PRODUKTY ZBOŻOWE ( mąki, kasza, ryż, płatki, pieczywo i makarony) Sągłównym

Bardziej szczegółowo

Rola materiałów odniesienia w zapewnieniu jakości wyników pomiarów chemicznych

Rola materiałów odniesienia w zapewnieniu jakości wyników pomiarów chemicznych Uniwersytet Warszawski Wydział Chemii Pasteura 1, 02-093 Warszawa Rola materiałów odniesienia w zapewnieniu jakości wyników pomiarów chemicznych Ewa Bulska ebulska@chem.uw.edu.pl Slide 1 Opracowanie i

Bardziej szczegółowo

Chromatografia. Chromatografia po co? Zastosowanie: Podstawowe rodzaje chromatografii. Chromatografia cienkowarstwowa - TLC

Chromatografia. Chromatografia po co? Zastosowanie: Podstawowe rodzaje chromatografii. Chromatografia cienkowarstwowa - TLC Chromatografia Chromatografia cienkowarstwowa - TLC Chromatografia po co? Zastosowanie: oczyszczanie wydzielanie analiza jakościowa analiza ilościowa Chromatogram czarnego atramentu Podstawowe rodzaje

Bardziej szczegółowo

JAK WYZNACZA SIĘ PARAMETRY WALIDACYJNE

JAK WYZNACZA SIĘ PARAMETRY WALIDACYJNE JAK WYZNACZA SIĘ PARAMETRY WALIDACYJNE 1 Przykład walidacji procedury analitycznej Piotr KONIECZKA Katedra Chemii Analitycznej Wydział Chemiczny Politechnika Gdańska ul. G. Narutowicza 11/1 80-33 GDAŃSK

Bardziej szczegółowo

OZNACZANIE ZAWARTOŚCI MANGANU W GLEBIE

OZNACZANIE ZAWARTOŚCI MANGANU W GLEBIE OZNACZANIE ZAWARTOŚCI MANGANU W GLEBIE WPROWADZENIE Przyswajalność pierwiastków przez rośliny zależy od procesów zachodzących między fazą stałą i ciekłą gleby oraz korzeniami roślin. Pod względem stopnia

Bardziej szczegółowo

SPIS TREŚCI PRZEDMOWA 11 1. WITAMINY 13 2. TŁUSZCZ MLECZNY: STRUKTURA, SKŁAD I WŁAŚCIWOŚCI PROZDROWOTNE 39

SPIS TREŚCI PRZEDMOWA 11 1. WITAMINY 13 2. TŁUSZCZ MLECZNY: STRUKTURA, SKŁAD I WŁAŚCIWOŚCI PROZDROWOTNE 39 PRZEDMOWA 11 1. WITAMINY 13 1.1. Charakterystyka ogólna i podział.......................... 13 1.2. Witaminy rozpuszczalne w tłuszczach....................... 16 1.2.1. Witamina A......................................

Bardziej szczegółowo

WYDZIAŁ NAUK O ŻYWNOŚCI I RYBACTWA

WYDZIAŁ NAUK O ŻYWNOŚCI I RYBACTWA WYDZIAŁ NAUK O ŻYWNOŚCI I RYBACTWA ZAKŁAD PODSTAW ŻYWIENIA CZŁOWIEKA Dr inż. Anna Bogacka, dr inż. Edyta Balejko Przedmiot: Żywienie człowieka Ćwiczenie nr 5 Temat: Wskaźniki oceny wartości odżywczej białek

Bardziej szczegółowo

(12) TŁUMACZENIE PATENTU EUROPEJSKIEGO (19) PL (11) (13) T3 (96) Data i numer zgłoszenia patentu europejskiego: 14.06.2006 06754350.

(12) TŁUMACZENIE PATENTU EUROPEJSKIEGO (19) PL (11) (13) T3 (96) Data i numer zgłoszenia patentu europejskiego: 14.06.2006 06754350. RZECZPOSPOLITA POLSKA (12) TŁUMACZENIE PATENTU EUROPEJSKIEGO (19) PL (11) PL/EP 1901698 (13) T3 (96) Data i numer zgłoszenia patentu europejskiego: 14.06.2006 06754350.4 (51) Int. Cl. A61K36/76 (2006.01)

Bardziej szczegółowo

CHROMATOGRAFIA W UKŁADACH FAZ ODWRÓCONYCH RP-HPLC

CHROMATOGRAFIA W UKŁADACH FAZ ODWRÓCONYCH RP-HPLC CHROMATOGRAFIA W UKŁADACH FAZ ODWRÓCONYCH RP-HPLC MK-EG-AS Wydział Chemiczny Politechniki Gdańskiej Gdańsk 2009 Chromatograficzne układy faz odwróconych (RP) Potocznie: Układy chromatograficzne, w których

Bardziej szczegółowo

PREZES URZĘDU OCHRONY KONKURENCJI I KONSUMENTÓW

PREZES URZĘDU OCHRONY KONKURENCJI I KONSUMENTÓW PREZES URZĘDU OCHRONY KONKURENCJI I KONSUMENTÓW DIH 023 16(9)09/GS Warszawa, 14 grudnia 2009 r. DECYZJA DIH-1/19/2009 Na podstawie art. 138 1 pkt 2 ustawy z dnia 14 czerwca 1960 r. Kodeks postępowania

Bardziej szczegółowo

Integralny proces czyszczenia narzędzi do tabletkowania środkami deconex

Integralny proces czyszczenia narzędzi do tabletkowania środkami deconex Integralny proces czyszczenia narzędzi do tabletkowania środkami deconex Dr Jolanta Kurz Rzeszów, 18 września 2103 Borer Chemie AG profesjonalne rozwiązywanie problemów Wiodący producent środków czyszczących

Bardziej szczegółowo

ZAKRES AKREDYTACJI LABORATORIUM BADAWCZEGO Nr AB 439

ZAKRES AKREDYTACJI LABORATORIUM BADAWCZEGO Nr AB 439 ZAKRES AKREDYTACJI LABORATORIUM BADAWCZEGO Nr AB 439 wydany przez POLSKIE CENTRUM AKREDYTACJI 01-382 Warszawa ul. Szczotkarska 42 Wydanie nr 16 Data wydania: 20 lipca 2016 r. Nazwa i adres AB 439 Kod identyfikacji

Bardziej szczegółowo

Ekstrakt z Chińskich Daktyli TIENS. Doskonałe odżywienie krwi i ukojenie nerwów

Ekstrakt z Chińskich Daktyli TIENS. Doskonałe odżywienie krwi i ukojenie nerwów Ekstrakt z Chińskich Daktyli TIENS Doskonałe odżywienie krwi i ukojenie nerwów Lekarze z Chin uważają, że owoce głożyny znane jako chińskie daktyle pomagają zachować sprawność, poprawiają odporność, wspomagają

Bardziej szczegółowo

Zakład Biologii Molekularnej Materiały do ćwiczeń z przedmiotu: BIOLOGIA MOLEKULARNA

Zakład Biologii Molekularnej Materiały do ćwiczeń z przedmiotu: BIOLOGIA MOLEKULARNA Zakład Biologii Molekularnej Materiały do ćwiczeń z przedmiotu: BIOLOGIA MOLEKULARNA Zakład Biologii Molekularnej Wydział Farmaceutyczny, WUM ul. Banacha 1, 02-097 Warszawa IZOLACJA DNA Z HODOWLI KOMÓRKOWEJ.

Bardziej szczegółowo

HPLC? HPLC cz.1. Analiza chromatograficzna. Klasyfikacja metod chromatograficznych

HPLC? HPLC cz.1. Analiza chromatograficzna. Klasyfikacja metod chromatograficznych HPLC cz.1 ver. 1.0 Literatura: 1. Witkiewicz Z. Podstawy chromatografii 2. Szczepaniak W., Metody instrumentalne w analizie chemicznej 3. Snyder L.R., Kirkland J.J., Glajch J.L. Practical HPLC Method Development

Bardziej szczegółowo

Problemy i wyzwania w analityce specjacyjnej z wykorzystaniem technik łączonych. Magdalena Jabłońska-Czapla

Problemy i wyzwania w analityce specjacyjnej z wykorzystaniem technik łączonych. Magdalena Jabłońska-Czapla Problemy i wyzwania w analityce specjacyjnej z wykorzystaniem technik łączonych Magdalena Jabłońska-Czapla Instytut Podstaw Inżynierii Środowiska PAN ul. M.Skłodowskiej-Curie 34 Zabrze Mobility of arsenic

Bardziej szczegółowo

na 10 sztuk: - do 4 tygodnia życia: 6 g/dzień - powyżej 4 tygodnia życia: 12 g/dzień - ptaki dorosłe: g/dzień

na 10 sztuk: - do 4 tygodnia życia: 6 g/dzień - powyżej 4 tygodnia życia: 12 g/dzień - ptaki dorosłe: g/dzień Dolmix DN Mieszanka paszowa uzupełniająca dla kur niosek utrzymywanych w chowie wolnowybiegowym. Zawiera muszle ostryg jako jedno ze źródeł wapnia, które powodują dobre wykształcenie i twardość skorup

Bardziej szczegółowo

HPLC_UPLC_PLC. Aparatura / problemy z aparaturą / sposoby ich eliminacji, minimalizacji (bez detekcji) 2/9/2014

HPLC_UPLC_PLC. Aparatura / problemy z aparaturą / sposoby ich eliminacji, minimalizacji (bez detekcji) 2/9/2014 HPLC_UPLC_PLC Aparatura / problemy z aparaturą / sposoby ich eliminacji, minimalizacji (bez detekcji) M. Kaminski Wiedzieć jaka jest przyczyna problemu, to najczęściej - potrafić samemu sobie poradzić

Bardziej szczegółowo

PARAMETRY TECHNICZNE I WARUNKI BEZWZGLĘDNIE WYMAGANE

PARAMETRY TECHNICZNE I WARUNKI BEZWZGLĘDNIE WYMAGANE PARAMETRY TECHNICZNE I WARUNKI BEZWZGLĘDNIE WYMAGANE Kwadrupolowy spektrometr mas z plazmą indukcyjnie sprzężoną ICP-MS z wyposażeniem i oprogramowaniem model/typ.... *; producent.....*; rok produkcji

Bardziej szczegółowo

Rumex. Rumex SC Oferta dla wymagających

Rumex. Rumex SC Oferta dla wymagających Rumex Rumex SC Oferta dla wymagających Rumex SC Skład Olejki eteryczne Żywe kultury drożdży (Saccharomyces cerevisiae) Saponiny Rumex SC Olejki eteryczne stymulują sekrecję soków trawiennych i zwiększają

Bardziej szczegółowo

DOSKONAŁA SUCHA KARMA DLA KOTÓW

DOSKONAŁA SUCHA KARMA DLA KOTÓW DOSKONAŁA SUCHA KARMA DLA KOTÓW DOSKONAŁA SUCHA KARMA DLA KOTÓW MATISSE Linia Matisse oferuje pełną gamę karm o wysokiej jakości dostosowanych do wszystkich ras kotów. Główne cechy linii Matisse to: Doskonały

Bardziej szczegółowo

NH 2 CH 3. Numer CAS: 106-49-0

NH 2 CH 3. Numer CAS: 106-49-0 Podstawy i Metody Oceny Środowiska Pracy 2011, nr 1(67), s. 155 160 dr SŁAWOMIR BRZEŹNICKI mgr MARZENA BONCZAROWSKA dr JAN GROMIEC Instytut Medycyny Pracy im. prof. dr med. Jerzego Nofera 91-348 Łódź ul.

Bardziej szczegółowo

OZNACZANIE ZAWARTOŚCI ROBENIDYNY W PRÓBKACH PASZY ZWIERZĘCEJ

OZNACZANIE ZAWARTOŚCI ROBENIDYNY W PRÓBKACH PASZY ZWIERZĘCEJ OZNACZANIE ZAWARTOŚCI ROBENIDYNY W PRÓBKACH PASZY ZWIERZĘCEJ Opracowali: dr inz. Agata Kot-Wasik dr inŝ. Andrzej Wasik mgr inŝ. Joanna Wilga CEL ĆWICZENIA Celem ćwiczenia jest porównanie czasochłonności

Bardziej szczegółowo

Kierunek i poziom studiów: Biotechnologia, pierwszy Sylabus modułu: Chemia ogólna (1BT_05)

Kierunek i poziom studiów: Biotechnologia, pierwszy Sylabus modułu: Chemia ogólna (1BT_05) Uniwersytet Śląski w Katowicach str. 1 Kierunek i poziom studiów: Biotechnologia, pierwszy Sylabus modułu: Chemia ogólna (1BT_05) 1. Informacje ogólne koordynator modułu/wariantu rok akademicki 2014/2015

Bardziej szczegółowo

Kwas trichlorooctowy

Kwas trichlorooctowy Podstawy i Metody Oceny Środowiska Pracy 2012, nr 1(71), s. 105 109 Kwas trichlorooctowy metoda oznaczania dr inż. ANNA JEŻEWSKA Centralny Instytut Ochrony Pracy Państwowy Instytut Badawczy 00-701 Warszawa

Bardziej szczegółowo

Oznaczanie mocznika w płynach ustrojowych metodą hydrolizy enzymatycznej

Oznaczanie mocznika w płynach ustrojowych metodą hydrolizy enzymatycznej Oznaczanie mocznika w płynach ustrojowych metodą hydrolizy enzymatycznej Wprowadzenie: Większość lądowych organizmów kręgowych część jonów amonowych NH + 4, produktu rozpadu białek, wykorzystuje w biosyntezie

Bardziej szczegółowo

TECHNOLOGIA ŻYWNOŚCI CZ. 1 PODSTAWY TECHNOLOGII ŻYWNOŚCI

TECHNOLOGIA ŻYWNOŚCI CZ. 1 PODSTAWY TECHNOLOGII ŻYWNOŚCI TECHNOLOGIA ŻYWNOŚCI CZ. 1 PODSTAWY TECHNOLOGII ŻYWNOŚCI Praca zbiorowa pod red. Ewy Czarnieckiej-Skubina SPIS TREŚCI Rozdział 1. Wiadomości wstępne 1.1. Definicja i zakres pojęcia technologia 1.2. Podstawowe

Bardziej szczegółowo

Krowi Milk: Krowa Super Vit Plus Dodatki: Składniki analityczne:

Krowi Milk: Krowa Super Vit Plus Dodatki: Składniki analityczne: Produkty Krowi Milk: to specjalnie wyselekcjonowane najlepsze surowce zróżnicowane źródła białka i energii w tym również tłuszcze chronione niezbędne witaminy i mikroelementy utrzymujące zwierzęta w najlepszej

Bardziej szczegółowo

Walidacja metody analitycznej podejście metrologiczne. Waldemar Korol Instytut Zootechniki-PIB, Krajowe Laboratorium Pasz w Lublinie

Walidacja metody analitycznej podejście metrologiczne. Waldemar Korol Instytut Zootechniki-PIB, Krajowe Laboratorium Pasz w Lublinie Walidacja metody analitycznej podejście metrologiczne Waldemar Korol Instytut Zootechniki-PIB, Krajowe Laboratorium Pasz w Lublinie Walidacja potwierdzenie parametrów metody do zamierzonego jej zastosowania

Bardziej szczegółowo

Centrum Doradztwa Rolniczego w Brwinowie. Praktyczne wykorzystanie

Centrum Doradztwa Rolniczego w Brwinowie. Praktyczne wykorzystanie Centrum Doradztwa Rolniczego w Brwinowie Praktyczne wykorzystanie RADOM 2013 CENTRUM DORADZTWA ROLNICZEGO W BRWINOWIE 26-600 Radom, ul. Chorzowska 16/18 e-mail: radom@cdr.gov.pl Praca zbiorowa: Danuta

Bardziej szczegółowo

ZAKRES AKREDYTACJI LABORATORIUM BADAWCZEGO Nr AB 1179

ZAKRES AKREDYTACJI LABORATORIUM BADAWCZEGO Nr AB 1179 ZAKRES AKREDYTACJI LABORATORIUM BADAWCZEGO Nr AB 1179 wydany przez POLSKIE CENTRUM AKREDYTACJI 01-382 Warszawa, ul. Szczotkarska 42 Wydanie nr 7 Data wydania: 24 kwietnia 2014 r. Nazwa i adres NUSCANA

Bardziej szczegółowo

WYKORZYSTANIE ZJAWISKA CHEMILUMINESCENCJI DO OZNACZANIA POLIFENOLI W UKŁADACH PRZEPŁYWOWYCH

WYKORZYSTANIE ZJAWISKA CHEMILUMINESCENCJI DO OZNACZANIA POLIFENOLI W UKŁADACH PRZEPŁYWOWYCH UNIWERSYTET W BIAŁYMSTOKU WYDZIAŁ BIOLOGICZNO-CHEMICZNY Edyta Monika Nalewajko-Sieliwoniuk WYKORZYSTANIE ZJAWISKA CHEMILUMINESCENCJI DO OZNACZANIA POLIFENOLI W UKŁADACH PRZEPŁYWOWYCH (streszczenie) Praca

Bardziej szczegółowo

1. Regulamin bezpieczeństwa i higieny pracy... 10 2. Pierwsza pomoc w nagłych wypadkach... 12 Literatura... 12

1. Regulamin bezpieczeństwa i higieny pracy... 10 2. Pierwsza pomoc w nagłych wypadkach... 12 Literatura... 12 Spis treści III. Wstęp... 9 III. Zasady porządkowe w pracowni technologicznej... 10 1. Regulamin bezpieczeństwa i higieny pracy... 10 2. Pierwsza pomoc w nagłych wypadkach... 12 Literatura... 12 III. Wskaźniki

Bardziej szczegółowo

ANEKS I. Strona 1 z 5

ANEKS I. Strona 1 z 5 ANEKS I WYKAZ NAZW, POSTAĆ FARMACEUTYCZNA, MOC WETERYNARYJNYCH PRODUKTÓW LECZNICZYCH, GATUNKI ZWIERZĄT, DROGA PODANIA, PODMIOT ODPOWIEDZIALNY POSIADAJĄCY POZWOLENIE NA DOPUSZCZENIE DO OBROTU W PAŃSTWACH

Bardziej szczegółowo

Techniki immunochemiczne. opierają się na specyficznych oddziaływaniach między antygenami a przeciwciałami

Techniki immunochemiczne. opierają się na specyficznych oddziaływaniach między antygenami a przeciwciałami Techniki immunochemiczne opierają się na specyficznych oddziaływaniach między antygenami a przeciwciałami Oznaczanie immunochemiczne RIA - ( ang. Radio Immuno Assay) techniki radioimmunologiczne EIA -

Bardziej szczegółowo

I. METODY POBIERANIA PRÓBEK DO CELÓW URZĘDOWEJ KONTROLI ZAWARTOŚCI CYNY W ŚRODKACH SPOŻYWCZYCH W OPAKOWANIACH METALOWYCH

I. METODY POBIERANIA PRÓBEK DO CELÓW URZĘDOWEJ KONTROLI ZAWARTOŚCI CYNY W ŚRODKACH SPOŻYWCZYCH W OPAKOWANIACH METALOWYCH ZAŁĄCZNIK Nr 5 METODY POBIERANIA PRÓBEK DO CELÓW URZĘDOWEJ KONTROLI ZAWARTOŚCI CYNY W ŚRODKACH SPOŻYWCZYCH W OPAKOWANIACH METALOWYCH ORAZ PRZYGOTOWYWANIE PRÓBEK I KRYTERIA WYBORU METOD ANALITYCZNYCH STOSOWANYCH

Bardziej szczegółowo

3. Analiza metabolomu zróżnicowanej chemicznie matrycy (Agnieszka Kraj)... 15

3. Analiza metabolomu zróżnicowanej chemicznie matrycy (Agnieszka Kraj)... 15 Części oznaczone ikonką dysku CD. znajdują się na dołączonym do książki. Autorzy...XVII. Słowo wstępne...xxi 1. Omika i biologia systemów (Jerzy Silberring, Anna Drabik)... 1 2. Wprowadzenie do proteomiki

Bardziej szczegółowo

Witamina C w produktach spożywczych i lekach farmaceutycznych

Witamina C w produktach spożywczych i lekach farmaceutycznych Witamina C w produktach spożywczych i lekach farmaceutycznych Opracowała Paulina Wojna uczennica II Liceum Ogólnokształcącego im. Mikołaja Kopernika w Lesznie z Oddziałami Dwujęzycznymi i Międzynarodowymi

Bardziej szczegółowo

ROZPORZĄDZENIE MINISTRA ŚRODOWISKA 1) z dnia 13 lipca 2010 r. w sprawie komunalnych osadów ściekowych. (Dz. U. z dnia 29 lipca 2010 r.

ROZPORZĄDZENIE MINISTRA ŚRODOWISKA 1) z dnia 13 lipca 2010 r. w sprawie komunalnych osadów ściekowych. (Dz. U. z dnia 29 lipca 2010 r. Dz.U.10.137.924 ROZPORZĄDZENIE MINISTRA ŚRODOWISKA 1) z dnia 13 lipca 2010 r. 2), 3) w sprawie komunalnych osadów ściekowych (Dz. U. z dnia 29 lipca 2010 r.) Na podstawie art. 43 ust. 7 ustawy z dnia 27

Bardziej szczegółowo

AmpliTest Salmonella spp. (Real Time PCR)

AmpliTest Salmonella spp. (Real Time PCR) AmpliTest Salmonella spp. (Real Time PCR) Zestaw do wykrywania sekwencji DNA specyficznych dla bakterii z rodzaju Salmonella techniką Real Time PCR Nr kat.: BAC01-50 Wielkość zestawu: 50 oznaczeń Objętość

Bardziej szczegółowo

Jakość plonu a równowaga składników pokarmowych w nawożeniu

Jakość plonu a równowaga składników pokarmowych w nawożeniu Jakość plonu a równowaga składników pokarmowych w nawożeniu Jan Łabętowicz, Wojciech Stępień 1. Względność pojęcia jakości plonu 2. Miejsce nawożenia w kształtowaniu jakości plonów 3. Azot jako główny

Bardziej szczegółowo

PODSTAWY LABORATORIUM PRZEMYSŁOWEGO. ĆWICZENIE 3a

PODSTAWY LABORATORIUM PRZEMYSŁOWEGO. ĆWICZENIE 3a PODSTAWY LABORATORIUM PRZEMYSŁOWEGO ĆWICZENIE 3a Analiza pierwiastkowa podstawowego składu próbek z wykorzystaniem techniki ASA na przykładzie fosforanów paszowych 1 I. CEL ĆWICZENIA Zapoznanie studentów

Bardziej szczegółowo

ĆWICZENIA Z BIOCHEMII

ĆWICZENIA Z BIOCHEMII ĆWICZENIA Z BIOCHEMII D U STUDENTfiW WYDZIAŁU LEKARSKIEGO Pod redakcją Piotra Laidlera, Barbary Piekarskiej, Marii Wróbel WYDAWNICTWO UNIWERSYTETU JAGIELLOŃSKIEGO ĆWICZENIA Z BIOCHEMII DLA STUDENTÓW WYDZIAŁU

Bardziej szczegółowo

MIESZANKI PASZOWE UZUPEŁNIAJĄCE 2,5% DLA BYDŁA

MIESZANKI PASZOWE UZUPEŁNIAJĄCE 2,5% DLA BYDŁA MIESZANKI PASZOWE UZUPEŁNIAJĄCE 2,5% DLA BYDŁA Przy stosowaniu MPU należy pamiętać, że wyżej wymienione efekty są możliwe tylko przy prawidłowym zbilansowaniu energetyczno-białkowym całej dawki pokarmowej.

Bardziej szczegółowo

CHARAKTERYSTYKA PRODUKTU LECZNICZEGO 1. NAZWA PRODUKTU LECZNICZEGO. PRIMENE 10% roztwór do infuzji 2. SKŁAD JAKOŚCIOWY I ILOŚCIOWY

CHARAKTERYSTYKA PRODUKTU LECZNICZEGO 1. NAZWA PRODUKTU LECZNICZEGO. PRIMENE 10% roztwór do infuzji 2. SKŁAD JAKOŚCIOWY I ILOŚCIOWY CHARAKTERYSTYKA PRODUKTU LECZNICZEGO 1. NAZWA PRODUKTU LECZNICZEGO PRIMENE 10% roztwór do infuzji 2. SKŁAD JAKOŚCIOWY I ILOŚCIOWY 100 ml roztworu do infuzji zawiera: L-Izoleucyna... L-Leucyna... L-Walina...

Bardziej szczegółowo

Badania biegłości w zakresie oznaczania składników mineralnych w paszach metodą AAS przykłady wykorzystania wyników

Badania biegłości w zakresie oznaczania składników mineralnych w paszach metodą AAS przykłady wykorzystania wyników Waldemar Korol, Grażyna Bielecka, Jolanta Rubaj, Sławomir Walczyński Instytut Zootechniki PIB, Krajowe Laboratorium Pasz w Lublinie Badania biegłości w zakresie oznaczania składników mineralnych w paszach

Bardziej szczegółowo

etyloamina Aminy mają właściwości zasadowe i w roztworach kwaśnych tworzą jon alkinowy

etyloamina Aminy mają właściwości zasadowe i w roztworach kwaśnych tworzą jon alkinowy Temat: Białka Aminy Pochodne węglowodorów zawierające grupę NH 2 Wzór ogólny amin: R NH 2 Przykład: CH 3 -CH 2 -NH 2 etyloamina Aminy mają właściwości zasadowe i w roztworach kwaśnych tworzą jon alkinowy

Bardziej szczegółowo

Wartośćodżywcza wybranych gatunków ryb na polskim rynku

Wartośćodżywcza wybranych gatunków ryb na polskim rynku Wartośćodżywcza wybranych gatunków ryb na polskim rynku dr inż. Joanna Szlinder-Richert Morski Instytut Rybacki-Państwowy Instytut Badawczy w Gdyni Gdańsk, 24 maj 2013 Dlaczego zaleca sięjedzenie ryb Strawne

Bardziej szczegółowo

5-18 miesięcy. 2-5 miesięcy. ponad 7 lat. 18 miesięcy - 7 lat. Fitmin Maxi Puppy. Fitmin Maxi Junior. Fitmin Maxi Maitenance. Fitmin Maxi Performance

5-18 miesięcy. 2-5 miesięcy. ponad 7 lat. 18 miesięcy - 7 lat. Fitmin Maxi Puppy. Fitmin Maxi Junior. Fitmin Maxi Maitenance. Fitmin Maxi Performance FITMIN MAXI Seria karm Fitmin przeznaczona jest dla psów ras olbrzymich, których waga przekracza 35. Karmy wyróżniają się między innymi większymi granulkami dla oraz zawartością siarczanu glukozaminy i

Bardziej szczegółowo

CAMERA SEPARATORIA. Volume 5, Number 2 / December 2013, 81-85

CAMERA SEPARATORIA. Volume 5, Number 2 / December 2013, 81-85 CAMERA SEPARATORIA Volume 5, Number 2 / December 2013, 81-85 Bronisław K. GŁÓD, Iwona KIERSZTYN, Monika SKWAREK, Paweł M. WANTUSIAK, Paweł PISZCZ Zakład Chemii Analitycznej, Instytut Chemii, Uniwersytet

Bardziej szczegółowo

MPU MINERALNE DLA PROSI T I WARCHLAKÓW

MPU MINERALNE DLA PROSI T I WARCHLAKÓW KOMPLEKSY ENZYMATYCZNE: Enzymatyczny: Rovabio - jest dodatkiem paszowym zawierającym naturalną, współdziałającą kombinacje 19 aktywności enzyma tycz nych. Poprawia wartości żywieniowe wszystkich materiałów

Bardziej szczegółowo

Pozostałości substancji niepożądanych w żywności i paszach - ocena zagrożeń. Andrzej Posyniak, Krzysztof Niemczuk PIWet-PIB Puławy

Pozostałości substancji niepożądanych w żywności i paszach - ocena zagrożeń. Andrzej Posyniak, Krzysztof Niemczuk PIWet-PIB Puławy Pozostałości substancji niepożądanych w żywności i paszach - ocena zagrożeń Andrzej Posyniak, Krzysztof Niemczuk PIWet-PIB Puławy Substancje niepożądane w żywności i paszach Substancje anaboliczne hormonalne

Bardziej szczegółowo

Suplementy. Wilkasy 2014. Krzysztof Gawin

Suplementy. Wilkasy 2014. Krzysztof Gawin Suplementy Wilkasy 2014 Krzysztof Gawin Suplementy diety - definicja Suplement diety jest środkiem spożywczym, którego celem jest uzupełnienie normalnej diety, będący skoncentrowanym źródłem witamin lub

Bardziej szczegółowo

Znajdź szkolenia dla siebie! Wybierz kategorię szkoleń: 1. Komunikacja i zarządzanie 2. 2. Laboratorium chemiczne Analiza instrumentalna 2

Znajdź szkolenia dla siebie! Wybierz kategorię szkoleń: 1. Komunikacja i zarządzanie 2. 2. Laboratorium chemiczne Analiza instrumentalna 2 Drogi Kliencie, Wiemy, że właśnie teraz planujesz szkolenia na 2016 r. Z nami te plany staną się prostsze. Stale myślimy o Twoich potrzebach szkoleniowych, dlatego przygotowaliśmy zestawienie tematów,

Bardziej szczegółowo