Selen, Se ŚLESIN. Toksyczność. Se Konieczność. Niedobór

Save this PDF as:
 WORD  PNG  TXT  JPG

Wielkość: px
Rozpocząć pokaz od strony:

Download "Selen, Se ŚLESIN. Toksyczność. Se 78.96. Konieczność. Niedobór"

Transkrypt

1 Opracowanie metod analitycznych przeznaczonych do charakterystyki dodatków żywnościowych i pasz przygotowanych na bazie drożdży wzbogaconych w selen 2006 dr inż. Aleksandra Polatajko

2 Selen, Se Toksyczność Konieczność Niedobór µg/dzień Se

3 Znaczenie biologiczne selenu 3 dla zdrowia człowieka zmniejsza ryzyko chorób nowotworowych, serca i układu krążenia wzmacnia sprawność układu odpornościowego zwiększa płodność oraz zapobiega poronieniom chroni przed przedwczesnym starzeniem zmniejsza ryzyko depresji poprawia wygląd skóry, włosów i paznokci...i zwierząt stymuluje właściwy wzrost wzmacnia sprawność układu odpornościowego zwiększa płodność u samic pomaga utrzymać świeżość produktów mięsnych dodaje mięsu soczystości i smaku polepsza kolor i teksturę mięsa zwiększa sprawność koni wyścigowych

4 Źródła selenu Człowiek Żywność bogata w selen Parafarmaceutyki na bazie drożdży wzbogaconych w selen Zwierzęta Dodatki paszowe na bazie drożdży wzbogaconych w selen µg /dzień mg /kg paszy

5 5 Dzienne zapotrzebowanie i aktualne spożycie selenu w wybranych państwach Kraj Australia Belgia Francja Japonia Kanada Niemcy Nowa Zelandia Polska Szwecja Szwajcaria Wielka Brytania USA Zalecane dzienne dawki spożycia Se µg/dzień Mężczyźni Kobiety Aktualne spożycie Se (teoretyczne)

6 Zawartości selenu w wybranych produktach żywnościowych 6 Produkt Orzechy brazylijskie Pszenica Tuńczyk w konserwie Prażone nasiona słonecznika Watroba drobiowa Maka pszenna Chude mieso i drób Czosnek Zawartośc selenu µg w 100g do 3000 ok

7 Zalecana forma selenu-l-selenomethionina CH 3 S CH 2 Se CH 3 Se CH 2 CH 2 + H 3 N C COO H CH 2 + H 3 N C COO H Methionina (Met) M Selenomethionina (SeMet) 7

8 Opracowanie metod analitycznych do charakterystyki drożdży selenowych i produktów pochodnych Frakcjonowanie i analiza specjacyjna selenu w drożdżach i paszach wzbogaconych w selen Analiza ilościowa selenometioniny, badanie jej stabilności i procesów utleniania Walidacja opracowanych metod analitycznych Systematyczna charakterystyka związków selenu obecnych w drożdżach wzbogaconych w selen Porównanie profili chromatograficznych (ang. fingerprinting) jako metoda określania źródeł pochodzenia produktów handlowych 8 Zaproponowanie metody ilościowego oznaczania białek zawierających selen

9 Stosowane techniki analityczne Przygotowanie próbki do analizy specjacyjnej 1. metody ekstrakcji nienaruszające struktury chemicznej związków 2. kontrolowana degradacja np. enzymatyczna Techniki sprzężone (SEC, AE, RP) 9 ICP MS Wysokosprawna chromatografia cieczowa ES MS/MS MALDI TOFMS

10 Frakcjonowanie związków selenu w drożdżach wzbogaconych w selen Wydajność ekstrakcji 100% 80% 60% 40% 20% 0% A B C D E F G H Próbki różnego pochodzenia Pozostałość Białka nierozpuszczalne w wodzie Związki selenu pozostające w strukturze ścian komórkowych Związki selenu rozpuszczalne w wodzie: selen nieorganiczny, selenoaminokwasy, niektóre proteiny zawierające selen 10 Ekstrakcja wodna Rozkład mieszaniną enzymów pektynolitycznych Ekstrakcja za pomocą SDS Rozkład kwasem azotowym

11 11 Analiza specjacyjna selenu w drożdżach i paszach wzbogaconych w selen Warunki 8 0.2g drożdży + roztwór chromatograficzne- AE proteazy Eluenty: A: 20 mm kwas octowy, 10 mm trietyloamina B: 200 mm kwas octowy, 100 mm trietyloamina Gradient: 0 5 min: 0 100% A wirowanie 5 30 min: 0 100% B10 min, 2500 rpm min: 100% B Przeplyw fazy ruchomej: 1.5 ml/min przesącz Granice wykrywalności: SeMet: 1-2 ng/g Se(IV)/Se(VI): Analiza 50 ng/gae HPLC-ICP MS 82 Se Intensywność x 10 4, cps mieszanie, 17h w 37 C 82 Se Intensywność x 10 3, cps 4 osad Czas, min SeMetO SeMet Wydajność ekstrakcji 93±4% Se SeMet 75±4 % Se(IV) x 2 Se(VI)

12 12 82 Se Intensywność x 10 4, cps Zastosowanie chromatografii dwuwymiarowej AE - SEC - ICP MS Chromatografia anionowymienna SeMetO SeMet I II III Czas, min Se Intensywność x 10 3, cps Frakcja I Frakcja II Frakcja III Czas elucji, min Chromatografia wykluczania SeMet+SeMetO 54 % 98 % 39 % SeMet SeMetO Se 7.1 ± 0.2 % 67 ± 1 % 26 ± 1 %

13 Walidacja opracowanych metod analitycznych metodą rozcieńczeń izotopowych (ang. Isotopic Dilution Analysis) Oznaczanie całkowitej zawartości Se niespecyficzny dodatek wzorca znakowanego izotopowo - Se 76 Oznaczanie SeMet specyficzny dodatek wzorca znakowanego izotopowo - SeMet 77 próbka Metoda dodatku wzorca wewn IDA ( 80 Se/ 76 Se) próbka Metoda dodatku wzorca wewn IDA ( 80 Se/ 77 Se) mg/kg mg/kg mg/kg mg/kg ± ± ± ± ± ± ± ± ± ± ± ±

14 Walidacja opracowanych metod analitycznych - udział w badaniach międzylaboratoryjnych Analizowana próbka: Drożdże wzbogacone w selen Oznaczanie całkowitej zawartości Se Oznaczanie SeMet 14 Całkowita zawartość Se x 10 3, mg/kg x numer laboratorium x x Stężenie selenometiony x 10 3, mg/kg numer laboratorium

15 15 Systematyczna charakterystyka związków selenu w drożdżach osad Próbka drożdży Próbka drożdży osad osad Ekstrakcja SDS przesącz Ekstrakcja wodna przesącz Frakcjonowanie przy użyciu SEC Ekstrakcja Driselasą przesącz Oczyszczanie frakcji charakterystyka charakterystyka przy przy użyciu użyciu SEC-ICP SEC-ICP MS, MS, RP RP HPLC-ICP HPLC-ICP MS, MS, ESI ESI MS/MS MS/MS rozkład trypsyną charakterystyka charakterystyka przy przy użyciu użyciu SEC-ICP SEC-ICP MS, MS, RP RP HPLC-ICP HPLC-ICP MS MS Frakcjonowanie przy użyciu RP HPLC rozkład proteazą charakterystyka charakterystyka przy przy użyciu użyciu MALDI MALDI TOF TOF MS, MS, ESI ESI MS/MS MS/MS charakterystyka charakterystyka przy przy użyciu użyciu SEC-ICP SEC-ICP MS, MS, RP RP HPLC-ICP HPLC-ICP MS MS charakterystyka charakterystyka przy przy użyciu użyciu SEC-ICP SEC-ICP MS MS

16 Se 3 Se Intensywność x ,, cps cps Charakterystyka wodnego ekstraktu drożdzy selenowych RP- ICP MS SEC-ICP MS 82 Se Intensywność x 10 4, cps Wielkocząsteczkowe frakcje Małocząsteczkowe frakcje Objętość elucji, ml ES TOF ES MS/MS ES TOF TOF MS/MS Baza danych MS/MS Baza danych 2 & & & 2 MALDI TOF MALDI MALDI MSTOF TOF MS MS HSP12 SIP18 Heat Salt Induced Shock Protein Czas, min

17 Opracowanie metody określania źródła pochodzenia produktów handlowych Przygotowanie próbki Stosowana aparatura drożdże mikroprzeplywowa HPLC pompa 106 µl min µl min -1 ekstrakcja wodna podzielnik przepływu fazy ruchomej rozkład enzymatyczny trypsyną dozownik kolumna kapilarna Kalibrator 4 µl min-1 przedkolumna komora mgielna 17 Analiza kapilara RP HPLC ICP MS ICP palnik mikronebulizer

18 18 80 Se Intensywność x 10 3, cps 80 Se Intensywność x 10 3, cps Porównanie profili chromatograficznych próbek produktów handlowych (ang. fingerprinting) Podobne profile chromatograficzne Czas, min 3 80 Se Intensywność x 10 3, cps 80 Se Intensywność x 10 4, cps Różne profile chromatograficzne Czas, min

19 Zastosowanie HPLC ICP MS do analizy ilościowej białek zawierających selen HSP12 (Heat-Shock Protein) SEKWENCJA AMINOKWASÓW MSDAGRKGFGEKASEALKPDSQKSYAEQGKEYIT- DKADKVAGKVQPEDNKGVFQGVHDSAEKGKDNAE- GQGESLADQAR- D Y M G A A K -SKLND AVEYVSGRVHGEEDPTKK 19 peptyd DYMGAAK (Asp-Tyr-Met-Gly-Ala-Ala-Lys) powstający po rozkładzie trypsyną białka HSP12 i jest dla niego charakterystyczny hydroliza enzymatyczna trypsyną białka HSP12 jest ilościowa izotopowo znakowany peptyd może być otrzymany przez: syntezę oczyszczenie z ekstraktu enzymatycznego izotopowo znakowanych drożdży

20 Przygotowanie izotopowo znakowanego ( 77 Se) wzorca Izotopowo ( 77 Se) znakowane drożdże ekstrakcja wodna wirowanie Frakcjonowanie przy użyciu SEC-ICP MS rozkład przy użyciu trypsyny wirowanie Frakcjonowanie przy użyciu RP-ICP MS 77 Se Intensywność x10 3, cps Se Intensywność x 10 3, cps Asp-Tyr-SeMet-Gly-Ala-Ala-Lys Numer frakcji Numer frakcji

21 Sprawdzenie czystości wyizolowanego peptydu Kapilarna RP HPLC ICP MS z komora zderzeniową 21 Intensywność x10 4, cps C Se =2.04 ± 0.02 µg Se g -1 C peptydu =24.5 ± 0.2 nmol g % Czas, min 82 Se 80 Se 77 Se 40

22 Analiza ilościowa metodą rozcieńczeń izotopowych-kapilarna RP HPLC-ICP MS Intensywność x10 3, cps Se 80 Se Próbka z dodatkiem znakowanego peptydu 77 Se/ 80 Se Stosunek izotopowy C Se = 66 ± 3 µg Se g -1 C peptydu = 0.84 ± 0.04 nmol g -1 C proteiny = 21.7 ± 1.1 nmol g Czas, min

23 Wnioski Opracowano i zwalidowano metody oznaczania całkowitej zawartości selenu i selenometioniny w drożdżach i paszach wzbogaconych w selen- niezbędne do kontroli jakości tych produktów Wykazano, iż 80% selenu w próbkach drożdży występuje w postaci selenometioniny, a cześć z niej jest niespecyficznie związana ze składnikami matrycy Przedstawiono pełną charakterystykę ilościową i jakościową związków selenu obecnych w drożdżach wzbogaconych w selen Opracowano metodę określania źródeł pochodzenia produktów handlowych (ang. fingerprinting) 23 Zaproponowano metodę ilościowej analizy białek zawierających selen metodą rozcieńczeń izotopowych z zastosowaniem kapilarnej RP HPLC ICP MS z komorą zderzeniową

24 Dziękuje za uwagę! 2006 dr inż. Aleksandra Polatajko

Podstawy chromatografii i technik elektromigracyjnych / Zygfryd Witkiewicz, Joanna Kałużna-Czaplińska. wyd. 6-1 w PWN. Warszawa, cop.

Podstawy chromatografii i technik elektromigracyjnych / Zygfryd Witkiewicz, Joanna Kałużna-Czaplińska. wyd. 6-1 w PWN. Warszawa, cop. Podstawy chromatografii i technik elektromigracyjnych / Zygfryd Witkiewicz, Joanna Kałużna-Czaplińska. wyd. 6-1 w PWN. Warszawa, cop. 2017 Spis treści Przedmowa 11 1. Wprowadzenie 13 1.1. Krótka historia

Bardziej szczegółowo

Podstawy chromatografii i technik elektromigracyjnych / Zygfryd Witkiewicz, Joanna Kałużna-Czaplińska. wyd. 5, 4 dodr. Warszawa, 2015.

Podstawy chromatografii i technik elektromigracyjnych / Zygfryd Witkiewicz, Joanna Kałużna-Czaplińska. wyd. 5, 4 dodr. Warszawa, 2015. Podstawy chromatografii i technik elektromigracyjnych / Zygfryd Witkiewicz, Joanna Kałużna-Czaplińska. wyd. 5, 4 dodr. Warszawa, 2015 Spis treści Przedmowa 11 1. Wprowadzenie 13 1.1. Krótka historia chromatografii

Bardziej szczegółowo

Zapytanie ofertowe nr 1/2014 ( dotyczy zamówienia badań )

Zapytanie ofertowe nr 1/2014 ( dotyczy zamówienia badań ) Zdrochem Sp. z o.o. Warszawa, 27 stycznia 2014 r. tel. +48 223900990, 609 019 283 fax. +48 223507490 info@zdrochem.pl www.zdrochem.pl I. ZAMAWIAJĄCY Zdrochem Sp. z o.o. NIP: 7010333468 REGON: 145983792

Bardziej szczegółowo

Instrukcja do ćwiczeń laboratoryjnych

Instrukcja do ćwiczeń laboratoryjnych UNIWERSYTET GDAŃSKI Pracownia studencka Katedry Analizy Środowiska Instrukcja do ćwiczeń laboratoryjnych Ćwiczenie nr 2 Oznaczanie benzoesanu denatonium w skażonym alkoholu etylowym metodą wysokosprawnej

Bardziej szczegółowo

Wpływ ilości modyfikatora na współczynnik retencji w technice wysokosprawnej chromatografii cieczowej

Wpływ ilości modyfikatora na współczynnik retencji w technice wysokosprawnej chromatografii cieczowej Wpływ ilości modyfikatora na współczynnik retencji w technice wysokosprawnej chromatografii cieczowej WPROWADZENIE Wysokosprawna chromatografia cieczowa (HPLC) jest uniwersalną techniką analityczną, stosowaną

Bardziej szczegółowo

TECHNIKA SPEKTROMETRII MAS ROZCIEŃCZENIA IZOTOPOWEGO (IDMS)-

TECHNIKA SPEKTROMETRII MAS ROZCIEŃCZENIA IZOTOPOWEGO (IDMS)- TECHNIKA SPEKTROMETRII MAS ROZCIEŃCZENIA IZOTOPOWEGO (IDMS)- - narzędzie dla poprawy jakości wyników analitycznych Jacek NAMIEŚNIK i Piotr KONIECZKA 1 Wprowadzenie Wyniki analityczne uzyskane w trakcie

Bardziej szczegółowo

IDENTYFIKACJA SUBSTANCJI W CHROMATOGRAFII CIECZOWEJ

IDENTYFIKACJA SUBSTANCJI W CHROMATOGRAFII CIECZOWEJ IDENTYFIKACJA SUBSTANCJI W CHROMATOGRAFII CIECZOWEJ Prof. dr hab. inż. Agata Kot-Wasik, prof. zw. PG agawasik@pg.gda.pl 11 Rozdzielenie + detekcja 22 Anality ZNANE Co oznaczamy? Anality NOWE NIEZNANE WWA

Bardziej szczegółowo

Jakość wyników specjacyjnego oznaczania pierwiastków techniką HPLC-ICP-MS

Jakość wyników specjacyjnego oznaczania pierwiastków techniką HPLC-ICP-MS Jakość wyników specjacyjnego oznaczania pierwiastków techniką HPLC-ICP-MS Danuta Barałkiewicz, Izabela Komorowicz, Barbara Pikosz, Magdalena Belter Pracownia Analizy Spektroskopowej Pierwiastków Wydział

Bardziej szczegółowo

Instrukcja do ćwiczeń laboratoryjnych

Instrukcja do ćwiczeń laboratoryjnych UNIWERSYTET GDAŃSKI WYDZIAŁ CHEMII Pracownia studencka Katedra Analizy Środowiska Instrukcja do ćwiczeń laboratoryjnych Ćwiczenie nr 2 OPTYMALIZACJA ROZDZIELANIA MIESZANINY WYBRANYCH FARMACEUTYKÓW METODĄ

Bardziej szczegółowo

PP7: Wymiana jonowa i chromatografia jonowymienna oznaczanie kationów i anionów

PP7: Wymiana jonowa i chromatografia jonowymienna oznaczanie kationów i anionów PP7: Wymiana jonowa i chromatografia jonowymienna oznaczanie kationów i anionów Instrukcja do ćwiczeń laboratoryjnych - ćwiczenie nr 7 przedmiot: Metody Analizy Technicznej kierunek studiów: Technologia

Bardziej szczegółowo

Pytania z Wysokosprawnej chromatografii cieczowej

Pytania z Wysokosprawnej chromatografii cieczowej Pytania z Wysokosprawnej chromatografii cieczowej 1. Jak wpłynie 50% dodatek MeOH do wody na retencję kwasu propionowego w układzie faz odwróconych? 2. Jaka jest kolejność retencji kwasów mrówkowego, octowego

Bardziej szczegółowo

Pytania z Chromatografii Cieczowej

Pytania z Chromatografii Cieczowej Pytania z Chromatografii Cieczowej 1. Podaj podstawowe różnice, z punktu widzenia użytkownika, między chromatografią gazową a cieczową (podpowiedź: (i) porównaj możliwości wpływu przez chromatografistę

Bardziej szczegółowo

(Tekst mający znaczenie dla EOG)

(Tekst mający znaczenie dla EOG) 6.5.2015 PL L 115/25 ROZPORZĄDZENIE WYKONAWCZE KOMISJI (UE) 2015/724 z dnia 5 maja 2015 r. dotyczące na stosowanie octanu retinylu, palmitynianu retinylu i propionianu retinylu jako dodatków paszowych

Bardziej szczegółowo

Opis przedmiotu zamówienia

Opis przedmiotu zamówienia 1 Załącznik nr 1 do Specyfikacji Istotnych Warunków Zamówienia Opis przedmiotu zamówienia Przedstawione niżej szczegółowe parametry zamawianej aparatury są parametrami minimalnymi. Wykonawca może zaproponować

Bardziej szczegółowo

Chemia kryminalistyczna

Chemia kryminalistyczna Chemia kryminalistyczna Wykład 2 Metody fizykochemiczne 21.10.2014 Pytania i pomiary wykrycie obecności substancji wykazanie braku substancji identyfikacja substancji określenie stężenia substancji określenie

Bardziej szczegółowo

METODYKA OZNACZANIA BARWNIKÓW ANTOCYJANOWYCH

METODYKA OZNACZANIA BARWNIKÓW ANTOCYJANOWYCH Zakład Przechowalnictwa i Przetwórstwa Owoców i Warzyw METODYKA OZNACZANIA BARWNIKÓW ANTOCYJANOWYCH I KAROTENÓW W OWOCACH BRZOSKWINI METODĄ CHROMATOGRAFICZNĄ Autorzy: dr inż. Monika Mieszczakowska-Frąc

Bardziej szczegółowo

OFERTA TEMATÓW PROJEKTÓW DYPLOMOWYCH (MAGISTERSKICH) do zrealizowania w Katedrze INŻYNIERII CHEMICZNEJ I PROCESOWEJ

OFERTA TEMATÓW PROJEKTÓW DYPLOMOWYCH (MAGISTERSKICH) do zrealizowania w Katedrze INŻYNIERII CHEMICZNEJ I PROCESOWEJ OFERTA TEMATÓW PROJEKTÓW DYPLOMOWYCH (MAGISTERSKICH) do zrealizowania w Katedrze INŻYNIERII CHEMICZNEJ I PROCESOWEJ Badania kinetyki utleniania wybranych grup związków organicznych podczas procesów oczyszczania

Bardziej szczegółowo

ANALIZA ŚLADOWYCH ZANIECZYSZCZEŃ ŚRODOWISKA I ROK OŚ II

ANALIZA ŚLADOWYCH ZANIECZYSZCZEŃ ŚRODOWISKA I ROK OŚ II ANALIZA ŚLADOWYCH ZANIECZYSZCZEŃ ŚRODOWISKA I ROK OŚ II Ćwiczenie 1 Przygotowanie próbek do oznaczania ilościowego analitów metodami wzorca wewnętrznego, dodatku wzorca i krzywej kalibracyjnej 1. Wykonanie

Bardziej szczegółowo

Techniki immunochemiczne. opierają się na specyficznych oddziaływaniach między antygenami a przeciwciałami

Techniki immunochemiczne. opierają się na specyficznych oddziaływaniach między antygenami a przeciwciałami Techniki immunochemiczne opierają się na specyficznych oddziaływaniach między antygenami a przeciwciałami Oznaczanie immunochemiczne RIA - ( ang. Radio Immuno Assay) techniki radioimmunologiczne EIA -

Bardziej szczegółowo

Wysokosprawna chromatografia cieczowa w analizie jakościowej i ilościowej

Wysokosprawna chromatografia cieczowa w analizie jakościowej i ilościowej Wysokosprawna chromatografia cieczowa w analizie jakościowej i ilościowej W analizie ilościowej z zastosowaniem techniki HPLC wykorzystuje się dwa możliwe schematy postępowania: kalibracja zewnętrzna sporządzenie

Bardziej szczegółowo

ZASTOSOWANIE WYSOKOSPRAWNEJ CHROMATOGRAFII CIECZOWEJ DO OZNACZANIA BENZOESANU SODU W PRODUKTACH SPOŻYWCZYCH

ZASTOSOWANIE WYSOKOSPRAWNEJ CHROMATOGRAFII CIECZOWEJ DO OZNACZANIA BENZOESANU SODU W PRODUKTACH SPOŻYWCZYCH ZASTOSOWANIE WYSOKOSPRAWNEJ CHROMATOGRAFII CIECZOWEJ DO OZNACZANIA BENZOESANU SODU W PRODUKTACH SPOŻYWCZYCH Instrukcja do ćwiczeń opracowana w Katedrze Chemii Środowiska Uniwersytetu Łódzkiego. 1. Wstęp

Bardziej szczegółowo

Kreacja aromatów. Techniki przygotowania próbek. Identyfikacja składników. Wybór składników. Kreacja aromatu

Kreacja aromatów. Techniki przygotowania próbek. Identyfikacja składników. Wybór składników. Kreacja aromatu Kreacja aromatów Techniki przygotowania próbek Identyfikacja składników Wybór składników Kreacja aromatu Techniki przygotowania próbek Ekstrakcja do fazy ciekłej Ekstrakcja do fazy stałej Desorpcja termiczna

Bardziej szczegółowo

Instrukcja ćwiczenia laboratoryjnego HPLC-2 Nowoczesne techniki analityczne

Instrukcja ćwiczenia laboratoryjnego HPLC-2 Nowoczesne techniki analityczne Instrukcja ćwiczenia laboratoryjnego HPLC-2 Nowoczesne techniki analityczne 1) OZNACZANIE ROZKŁADU MASY CZĄSTECZKOWEJ POLIMERÓW Z ASTOSOWANIEM CHROMATOGRAFII ŻELOWEJ; 2) PRZYGOTOWANIE PRÓBKI Z ZASTOSOWANIEM

Bardziej szczegółowo

TECHNIKI SEPARACYJNE ĆWICZENIE. Temat: Problemy identyfikacji lotnych kwasów tłuszczowych przy zastosowaniu układu GC-MS (SCAN, SIM, indeksy retencji)

TECHNIKI SEPARACYJNE ĆWICZENIE. Temat: Problemy identyfikacji lotnych kwasów tłuszczowych przy zastosowaniu układu GC-MS (SCAN, SIM, indeksy retencji) TECHNIKI SEPARACYJNE ĆWICZENIE Temat: Problemy identyfikacji lotnych kwasów tłuszczowych przy zastosowaniu układu GC-MS (SCAN, SIM, indeksy retencji) Prowadzący: mgr inż. Anna Banel 1 1. Charakterystyka

Bardziej szczegółowo

KATEDRA CHEMII BIOMEDYCZNEJ

KATEDRA CHEMII BIOMEDYCZNEJ Sylwia Rodziewicz-Motowidło KATEDRA CHEMII BIOMEDYCZNEJ Katedra Chemii Biomedycznej dr hab. Sylwia Rodziewicz-Motowidło budynek A, piętro I i parter Pracownia Chemii Medycznej dr hab. Sylwia Rodziewicz-Motowidło

Bardziej szczegółowo

Tabela potwierdzenia informacji rejestracyjnych przedsiębiorstwa produkcji importowanego mleka pasteryzowanego

Tabela potwierdzenia informacji rejestracyjnych przedsiębiorstwa produkcji importowanego mleka pasteryzowanego Tabela potwierdzenia informacji rejestracyjnych przedsiębiorstwa produkcji importowanego mleka pasteryzowanego 1. Podstawowe informacje na temat przedsiębiorstwa (wypełnia przedsiębiorstwo ubiegające się)

Bardziej szczegółowo

KALKULACJA CENY OFERTY Część I - Odczynniki do analiz rutynowych Jednostka miary. op. = 1l 4. op. = 250g 1. op. = 100g 1

KALKULACJA CENY OFERTY Część I - Odczynniki do analiz rutynowych Jednostka miary. op. = 1l 4. op. = 250g 1. op. = 100g 1 AGZ.272013 4-Amino-antypiryna Część I - Odczynniki do analiz rutynowych zawartość: min. 98 %; straty po suszeniu (105 C) - max. 0,5 %. op.= 25g 1 brutto [zł] 1-butanol zawartość: min. 99,5 %; woda - max.

Bardziej szczegółowo

Wysokosprawna chromatografia cieczowa dobór warunków separacji wybranych związków

Wysokosprawna chromatografia cieczowa dobór warunków separacji wybranych związków Wysokosprawna chromatografia cieczowa dobór warunków separacji wybranych związków Instrukcja do ćwiczeń opracowana w Katedrze Chemii Środowiska Uniwersytetu Łódzkiego Opis programu do ćwiczeń Po włączeniu

Bardziej szczegółowo

Identyfikacja substancji pochodzenia roślinnego z użyciem detektora CORONA CAD

Identyfikacja substancji pochodzenia roślinnego z użyciem detektora CORONA CAD Identyfikacja substancji pochodzenia roślinnego z użyciem detektora CORONA CAD Przemysław Malec Department of Plant Physiology and Biochemistry, Faculty of Biochemistry, Biophysics and Biotechnology, Jagiellonian

Bardziej szczegółowo

Jonizacja plazmą wzbudzaną indukcyjnie (ICP)

Jonizacja plazmą wzbudzaną indukcyjnie (ICP) Jonizacja plazmą wzbudzaną indukcyjnie (ICP) Inductively Coupled Plasma Ionization Opracowane z wykorzystaniem materiałów dr Katarzyny Pawlak z Wydziału Chemicznego PW Schemat spektrometru ICP MS Rozpylacz

Bardziej szczegółowo

masy cząsteczkowej polimerów nisko i średnio polarnych, a także lipidów, fosfolipidów itp.. silanizowanyżel krzemionkowy

masy cząsteczkowej polimerów nisko i średnio polarnych, a także lipidów, fosfolipidów itp.. silanizowanyżel krzemionkowy CHROMATOGRAFIA WYKLUCZANIA (dawniej ŻELOWA PC/SEC) Układy chromatograficzne typu GPC / SEC 1. W warunkach nie-wodnych - eluenty: THF, dioksan, czerochloroetylen, chlorobenzen, ksylen; fazy stacjonarne:

Bardziej szczegółowo

OD HPLC do UPLC. Prof. dr hab. inż. Agata Kot-Wasik. Katedra Chemii Analitycznej Wydział Chemiczny, Politechnika Gdańska

OD HPLC do UPLC. Prof. dr hab. inż. Agata Kot-Wasik. Katedra Chemii Analitycznej Wydział Chemiczny, Politechnika Gdańska OD HPLC do UPLC Katedra Chemii Analitycznej Wydział Chemiczny, Politechnika Gdańska 1 PREHISTORIA 1966 Chromatogram autorstwa L.R.Snyder Analiza chinolin LC-GC North America, 30(4), 328-341, 2012 2 PREHISTORIA

Bardziej szczegółowo

GraŜyna Chwatko Zakład Chemii Środowiska

GraŜyna Chwatko Zakład Chemii Środowiska Chromatografia podstawa metod analizy laboratoryjnej GraŜyna Chwatko Zakład Chemii Środowiska Chromatografia gr. chromatos = barwa grapho = pisze Michaił Siemionowicz Cwiet 2 Chromatografia jest metodą

Bardziej szczegółowo

ZAKRES AKREDYTACJI LABORATORIUM BADAWCZEGO Nr AB 775

ZAKRES AKREDYTACJI LABORATORIUM BADAWCZEGO Nr AB 775 ZAKRES AKREDYTACJI LABORATORIUM BADAWCZEGO Nr AB 775 wydany przez POLSKIE CENTRUM AKREDYTACJI 01-382 Warszawa, ul. Szczotkarska 42 Wydanie nr 11 Data wydania: 22 sierpnia 2016 r. AB 775 Nazwa i adres GŁÓWNY

Bardziej szczegółowo

Gel-Out. 50 izolacji, 250 izolacji. Nr kat , Zestaw do izolacji DNA z żelu agarozowego. wersja 0617

Gel-Out. 50 izolacji, 250 izolacji. Nr kat , Zestaw do izolacji DNA z żelu agarozowego. wersja 0617 Gel-Out Zestaw do izolacji DNA z żelu agarozowego. wersja 0617 50 izolacji, 250 izolacji Nr kat. 023-50, 023-250 Pojemność kolumny do izolacji DNA - do 20 µg DNA, minimalna pojemność - 2 µg DNA (przy zawartości

Bardziej szczegółowo

BADANIE ZAWARTOŚCI WIELOPIERŚCIENIOWYCH WĘGLOWODORÓW AROMATYCZNYCH (OZNACZANIE ANTRACENU W PRÓBKACH GLEBY).

BADANIE ZAWARTOŚCI WIELOPIERŚCIENIOWYCH WĘGLOWODORÓW AROMATYCZNYCH (OZNACZANIE ANTRACENU W PRÓBKACH GLEBY). BADANIE ZAWARTOŚCI WIELOPIERŚCIENIOWYCH WĘGLOWODORÓW AROMATYCZNYCH (OZNACZANIE ANTRACENU W PRÓBKACH GLEBY). Wprowadzenie: Wielopierścieniowe węglowodory aromatyczne (WWA) to grupa związków zawierających

Bardziej szczegółowo

Instrukcja do ćwiczeń laboratoryjnych

Instrukcja do ćwiczeń laboratoryjnych UNIWERSYTET GDAŃSKI Pracownia studencka Zakład Analizy Środowiska Instrukcja do ćwiczeń laboratoryjnych Ćwiczenie nr 3 Oznaczanie witaminy E w oleju metodą HPLC ANALIZA PRODUKTÓW POCHODZENIA NATURALNEGO

Bardziej szczegółowo

VITA-MIN Plus połączenie witamin i minerałów, stworzone z myślą o osobach aktywnie uprawiających sport.

VITA-MIN Plus połączenie witamin i minerałów, stworzone z myślą o osobach aktywnie uprawiających sport. Witaminy i minerały > Model : Producent : Olimp VITAMIN Plus połączenie witamin i minerałów, stworzone z myślą o osobach aktywnie uprawiających sport. DZIAŁA PROZDROWOTNIE WZMACNIA SYSTEM ODPORNOŚCIOWY

Bardziej szczegółowo

e) nasiona słonecznika; śruta poekstrakcyjna słonecznikowa; śruta poekstrakcyjna słonecznikowa z częściowo obłuszczonych nasion słonecznika;

e) nasiona słonecznika; śruta poekstrakcyjna słonecznikowa; śruta poekstrakcyjna słonecznikowa z częściowo obłuszczonych nasion słonecznika; 12.2.2008 Dziennik Urzędowy Unii Europejskiej L 37/3 ROZPORZĄDZENIE KOMISJI (WE) NR 121/2008 z dnia 11 lutego 2008 r. określające metodę analizy do oznaczania zawartości skrobi w preparatach w rodzaju

Bardziej szczegółowo

Novabeads Food DNA Kit

Novabeads Food DNA Kit Novabeads Food DNA Kit Novabeads Food DNA Kit jest nowej generacji narzędziem w technikach biologii molekularnej, umożliwiającym izolację DNA z produktów spożywczych wysoko przetworzonych. Metoda oparta

Bardziej szczegółowo

Chromatogramy Załącznik do instrukcji z Technik Rozdzielania Mieszanin

Chromatogramy Załącznik do instrukcji z Technik Rozdzielania Mieszanin Chromatogramy Załącznik do instrukcji z Technik Rozdzielania Mieszanin Badania dotyczące dobrania wypełnienia o odpowiednim zakresie wielkości porów, zapewniających wnikanie wszystkich molekuł warunki

Bardziej szczegółowo

Wrocław, 17/12/2012 Strona 1/7 RAPORT Z BADAŃ

Wrocław, 17/12/2012 Strona 1/7 RAPORT Z BADAŃ Wrocław, 17/12/2012 Strona 1/7 RAPORT Z BADAŃ OTRZYMYWANIE ORAZ CHARAKTERYSTYKA PREPARATU POLIFENOLOWOEGO OTRZYMANEGO W DRODZE EKSTRAKCJI Z WYCHMIELIN EO4 I. PRZEDMIOT ORAZ ZAKRES BADAŃ Przedmiotem badań

Bardziej szczegółowo

ZAKRES AKREDYTACJI OiB Nr 53/MON/2016

ZAKRES AKREDYTACJI OiB Nr 53/MON/2016 Grupa 15 ZAKRES AKREDYTACJI OiB Nr 53/MON/2016 Wydanie 1 LABORATORIUM J.S. HAMILTON POLAND S.A. 81-571 Gdynia, ul. Chwaszczyńska 180 Załącznik do Decyzji Nr 46 Ministra Obrony Narodowej z dnia 20 października

Bardziej szczegółowo

Analiza GC alkoholi C 1 C 5. Ćwiczenie polega na oznaczeniu składu mieszaniny ciekłych związków, w skład

Analiza GC alkoholi C 1 C 5. Ćwiczenie polega na oznaczeniu składu mieszaniny ciekłych związków, w skład Analiza GC alkoholi C 1 C 5 Ćwiczenie polega na oznaczeniu składu mieszaniny ciekłych związków, w skład której mogą wchodzić, następujące alkohole (w nawiasie podano nazwy zwyczajowe): Metanol - CH 3 OH,

Bardziej szczegółowo

Wydziału Biotechnologii i Nauk o Żywności

Wydziału Biotechnologii i Nauk o Żywności Pracownie i laboratoria dydaktyczno-badawcze Wydziału Biotechnologii i Nauk o Żywności rozmieszczone są w czterech instytutach biorących udział w realizacji w/w zadań: Instytut Podstaw Chemii Żywności

Bardziej szczegółowo

Laboratorium Pomorskiego Parku Naukowo-Technologicznego Gdynia.

Laboratorium Pomorskiego Parku Naukowo-Technologicznego Gdynia. Laboratorium Pomorskiego Parku Naukowo-Technologicznego Gdynia www.ppnt.pl/laboratorium Laboratorium jest częścią modułu biotechnologicznego Pomorskiego Parku Naukowo Technologicznego Gdynia. poprzez:

Bardziej szczegółowo

Ingredients Research Concepts Consultancy Production for the dairy industry. Milase Premium. Marta Misiuwianiec-Królikiewicz

Ingredients Research Concepts Consultancy Production for the dairy industry. Milase Premium. Marta Misiuwianiec-Królikiewicz Ingredients Research Concepts Consultancy Production for the dairy industry Milase Premium Marta Misiuwianiec-Królikiewicz Zawartość Obecne na rynku koagulanty Koagulacja mleka Milase Premium Koagulanty

Bardziej szczegółowo

ROZDZIELENIE OD PODSTAW czyli wszystko (?) O KOLUMNIE CHROMATOGRAFICZNEJ

ROZDZIELENIE OD PODSTAW czyli wszystko (?) O KOLUMNIE CHROMATOGRAFICZNEJ ROZDZIELENIE OD PODSTAW czyli wszystko (?) O KOLUMNIE CHROMATOGRAFICZNEJ Prof. dr hab. inż. Agata Kot-Wasik Katedra Chemii Analitycznej Wydział Chemiczny, Politechnika Gdańska agawasik@pg.gda.pl ROZDZIELENIE

Bardziej szczegółowo

Materiał obowiązujący do ćwiczeń z analizy instrumentalnej II rok OAM

Materiał obowiązujący do ćwiczeń z analizy instrumentalnej II rok OAM Materiał obowiązujący do ćwiczeń z analizy instrumentalnej II rok OAM Ćwiczenie 1 Zastosowanie statystyki do oceny metod ilościowych Błąd gruby, systematyczny, przypadkowy, dokładność, precyzja, przedział

Bardziej szczegółowo

Ekstrakt z Chińskich Daktyli

Ekstrakt z Chińskich Daktyli Ekstrakt z Chińskich Daktyli Ekstrakt z Chińskich Daktyli TIENS Lekarze z Chin uważają, że owoce głożyny znane jako chińskie daktyle Pomagają zachować sprawność Poprawiają odporność Wspomagają pracę żołądka

Bardziej szczegółowo

Cz. 5. Podstawy instrumentalizacji chromatografii. aparatura chromatograficzna w skali analitycznej i modelowej - -- w części przypomnienie -

Cz. 5. Podstawy instrumentalizacji chromatografii. aparatura chromatograficzna w skali analitycznej i modelowej - -- w części przypomnienie - Chromatografia cieczowa jako technika analityki, przygotowania próbek, wsadów do rozdzielania, technika otrzymywania grup i czystych substancji Cz. 5. Podstawy instrumentalizacji chromatografii aparatura

Bardziej szczegółowo

Chromatografia. Chromatografia po co? Zastosowanie: Optymalizacja eluentu. Chromatografia kolumnowa. oczyszczanie. wydzielanie. analiza jakościowa

Chromatografia. Chromatografia po co? Zastosowanie: Optymalizacja eluentu. Chromatografia kolumnowa. oczyszczanie. wydzielanie. analiza jakościowa Chromatografia Chromatografia kolumnowa Chromatografia po co? Zastosowanie: oczyszczanie wydzielanie Chromatogram czarnego atramentu analiza jakościowa analiza ilościowa Optymalizacja eluentu Optimum 0.2

Bardziej szczegółowo

Ilościowa analiza mieszaniny alkoholi techniką GC/FID

Ilościowa analiza mieszaniny alkoholi techniką GC/FID Ilościowa analiza mieszaniny alkoholi techniką GC/FID WPROWADZENIE Pojęcie chromatografii obejmuje grupę metod separacji substancji, w których występują diw siły: siła powodująca ruch cząsteczek w określonym

Bardziej szczegółowo

ANALITYKA PRZEMYSŁOWA I ŚRODOWISKOWA

ANALITYKA PRZEMYSŁOWA I ŚRODOWISKOWA Zakład ad Chemii Analitycznej Laboratorium Analiz Śladowych Politechniki Krakowskiej Wydział Inżynierii i Technologii Chemicznej ANALITYKA PRZEMYSŁOWA I ŚRODOWISKOWA Laboratorium Analiz Śladowych IIIp..

Bardziej szczegółowo

Oznaczanie jonów organicznych i nieorganicznych w cukrze. Wydział Biotechnologii i Nauk o Żywności. mgr inż. Aneta Antczak

Oznaczanie jonów organicznych i nieorganicznych w cukrze. Wydział Biotechnologii i Nauk o Żywności. mgr inż. Aneta Antczak Politechnika Łódzka Oznaczanie jonów organicznych i nieorganicznych w cukrze mgr inż. Aneta Antczak Instytut Chemicznej Technologii Żywności Specjalistyczne Laboratorium Analityki Cukrowniczej Wydział

Bardziej szczegółowo

TIENS SKONCENTROWANY EKSTARKT Z DAKTYLI CHIŃSKICH

TIENS SKONCENTROWANY EKSTARKT Z DAKTYLI CHIŃSKICH TIENS SKONCENTROWANY EKSTARKT Z DAKTYLI CHIŃSKICH TIENS SKONCENTROWANY EKSTRAKT Z DAKTYLI CHIŃSKICH Główny surowiec Skoncentrowanego Ekstraktu z Daktyli Chińskich TIENS to najwyższej jakości owoce głożyny

Bardziej szczegółowo

Bezinwazyjne badania specjacji

Bezinwazyjne badania specjacji Uniwersytet Warszawski Wydział Chemii Bezinwazyjne badania specjacji prof. dr hab. Ewa Bulska rok akademicki 214 / 215 Przykład I Korozja atramentowa atramenty żelazowo-galusowe w zabytkach rękopiśmiennych

Bardziej szczegółowo

Spis treści. Aparatura

Spis treści. Aparatura Spis treści Aparatura I. Podstawowe wyposażenie laboratoryjne... 13 I.I. Probówki i naczynia laboratoryjne... 13 I.II. Pipety... 17 I.II.I. Rodzaje pipet automatycznych... 17 I.II.II. Techniki pipetowania...

Bardziej szczegółowo

EquiPower Reiskeimöl Olej z zarodków ryżu

EquiPower Reiskeimöl Olej z zarodków ryżu EquiPower Reiskeimöl Olej z zarodków ryżu o trzykierunkowym działaniu 1) Wzmacnia budowę mięśni 2) Poprawia siłę mięśniową 3) Stabilizuje przemianę energii i materii bez obciążania białkiem Składniki analityczne:

Bardziej szczegółowo

KALIBRACJA. ważny etap procedury analitycznej. Dr hab. inż. Piotr KONIECZKA

KALIBRACJA. ważny etap procedury analitycznej. Dr hab. inż. Piotr KONIECZKA KALIBRAJA ważny etap procedury analitycznej 1 Dr hab. inż. Piotr KONIEZKA Katedra hemii Analitycznej Wydział hemiczny Politechnika Gdańska ul. G. Narutowicza 11/12 8-233 GDAŃK e-mail: piotr.konieczka@pg.gda.pl

Bardziej szczegółowo

RodeVit Multi. WITAMINY, MINERAŁY, AMINOKWASY dla gryzoni i królików

RodeVit Multi. WITAMINY, MINERAŁY, AMINOKWASY dla gryzoni i królików RodeVit Multi WITAMINY, MINERAŁY, AMINOKWASY dla gryzoni i królików Właściwości RodeVit Multi zawiera zestaw witamin, mikro i makroelementów oraz aminokwasów. Składniki preparatu uzupełniają niedobory

Bardziej szczegółowo

Połączenie HPLC z ICP-MS

Połączenie HPLC z ICP-MS Nowoczesne metody analityczne wykorzystujące detektor mas Zastosowanie ICP MS do badania specjacji ICP MS : Spektrometria mas ze wzbudzeniem w plazmie indukcyjnie sprzężonej (analiza ultra-śladowa) LA

Bardziej szczegółowo

SPIS TREŚCI. 1. Znaczenie nauki o żywieniu. 2. Gospodarka energetyczna organizmu człowieka. 3. Podstawowe składniki pokarmowe i ich rola

SPIS TREŚCI. 1. Znaczenie nauki o żywieniu. 2. Gospodarka energetyczna organizmu człowieka. 3. Podstawowe składniki pokarmowe i ich rola 3 SPIS TREŚCI 1. Znaczenie nauki o żywieniu 1.1. Cele i zadania nauki o żywieniu................................................8 1.2. Rozwój nauki o żywieniu człowieka.............................................9

Bardziej szczegółowo

TaqNova-RED. Polimeraza DNA RP20R, RP100R

TaqNova-RED. Polimeraza DNA RP20R, RP100R TaqNova-RED Polimeraza DNA RP20R, RP100R RP20R, RP100R TaqNova-RED Polimeraza DNA Rekombinowana termostabilna polimeraza DNA Taq zawierająca czerwony barwnik, izolowana z Thermus aquaticus, o przybliżonej

Bardziej szczegółowo

-- w części przypomnienie - Gdańsk 2010

-- w części przypomnienie - Gdańsk 2010 Chromatografia cieczowa jako technika analityki, przygotowania próbek, wsadów do rozdzielania, technika otrzymywania grup i czystych substancji Cz. 4. --mechanizmy retencji i selektywności -- -- w części

Bardziej szczegółowo

Rys. 1. Chromatogram i sposób pomiaru podstawowych wielkości chromatograficznych

Rys. 1. Chromatogram i sposób pomiaru podstawowych wielkości chromatograficznych Ćwiczenie 1 Chromatografia gazowa wprowadzenie do techniki oraz analiza jakościowa Wstęp Celem ćwiczenia jest nabycie umiejętności obsługi chromatografu gazowego oraz wykonanie analizy jakościowej za pomocą

Bardziej szczegółowo

Opracowanie metodyk METODYKA OZNACZANIA KWASU ASKORBINOWEGO,

Opracowanie metodyk METODYKA OZNACZANIA KWASU ASKORBINOWEGO, Zakład Przechowalnictwa i Przetwórstwa Owoców i Warzyw Opracowanie metodyk METODYKA OZNACZANIA KWASU ASKORBINOWEGO, KWASU JABŁKOWEGO I KWASU CYTRYNOWEGO W JABŁKACH, GRUSZKACH I BRZOSKWINIACH Autorzy: dr

Bardziej szczegółowo

Dziennik Urzędowy Unii Europejskiej

Dziennik Urzędowy Unii Europejskiej L 174/8 PL 3.7.2015 ROZPORZĄDZENIE WYKONAWCZE KOMISJI (UE) 2015/1061 z dnia 2 lipca 2015 r. dotyczące na stosowanie kwasu askorbinowego, soli sodowej fosforanu askorbylu, soli sodowo-wapniowej fosforanu

Bardziej szczegółowo

TaqNovaHS. Polimeraza DNA RP902A, RP905A, RP910A, RP925A RP902, RP905, RP910, RP925

TaqNovaHS. Polimeraza DNA RP902A, RP905A, RP910A, RP925A RP902, RP905, RP910, RP925 TaqNovaHS RP902A, RP905A, RP910A, RP925A RP902, RP905, RP910, RP925 RP902A, RP905A, RP910A, RP925A RP902, RP905, RP910, RP925 TaqNovaHS Polimeraza TaqNovaHS jest mieszaniną termostabilnej polimerazy DNA

Bardziej szczegółowo

Genomic Mini AX Milk Spin

Genomic Mini AX Milk Spin Genomic Mini AX Milk Spin Zestaw o zwiększonej wydajności do izolacji genomowego DNA z próbek mleka. wersja 1017 100 izolacji Nr kat. 059-100S Pojemność kolumny do oczyszczania DNA wynosi 15 μg. Produkt

Bardziej szczegółowo

CHOLESTONE NATURALNA OCHRONA PRZED MIAŻDŻYCĄ. www.california-fitness.pl www.calivita.com

CHOLESTONE NATURALNA OCHRONA PRZED MIAŻDŻYCĄ. www.california-fitness.pl www.calivita.com CHOLESTONE NATURALNA OCHRONA PRZED MIAŻDŻYCĄ Co to jest cholesterol? Nierozpuszczalna w wodzie substancja, która: jest składnikiem strukturalnym wszystkich błon komórkowych i śródkomórkowych wchodzi w

Bardziej szczegółowo

PRODUKTY PLUS FIRMY TIENS

PRODUKTY PLUS FIRMY TIENS PRODUKTY PLUS FIRMY TIENS PRODUKTY PLUS FIRMY TIENS TIENS POLSKA PRZEDSTAWIA NOWĄ SERIĘ PRODUKTÓW PLUS 5000 lat chińskiej tradycji i wiedzy połączone z najnowszą technologią z Europy PRODUTY PLUS FIRMY

Bardziej szczegółowo

Laboratorium Utylizacji Odpadów (Laboratorium Badawcze Biologiczno Chemiczne)

Laboratorium Utylizacji Odpadów (Laboratorium Badawcze Biologiczno Chemiczne) Laboratorium Utylizacji Odpadów (Laboratorium Badawcze Biologiczno Chemiczne) mgr inż. Maria Sadowska mgr Katarzyna Furmanek mgr inż. Marcin Młodawski Laboratorium prowadzi prace badawcze w zakresie: Utylizacji

Bardziej szczegółowo

Niniejsze rozporządzenie wiąże w całości i jest bezpośrednio stosowane we wszystkich państwach członkowskich.

Niniejsze rozporządzenie wiąże w całości i jest bezpośrednio stosowane we wszystkich państwach członkowskich. 10.2.2010 Dziennik Urzędowy Unii Europejskiej L 37/21 ROZPORZĄDZENIE KOMISJI (UE) NR 118/2010 z dnia 9 lutego 2010 r. zmieniające rozporządzenie (WE) nr 900/2008 ustanawiające metody analizy i inne przepisy

Bardziej szczegółowo

Odpowiedzialność za miarodajność wyników pomiarów poprzez zapewnienie ich spójności

Odpowiedzialność za miarodajność wyników pomiarów poprzez zapewnienie ich spójności Odpowiedzialność za miarodajność wyników pomiarów poprzez zapewnienie ich spójności Danuta Barałkiewicz Pracownia Analizy Spektroskopowej Pierwiastków Wydział Chemii UAM w Poznaniu Walidacja (dobór metody)

Bardziej szczegółowo

BIOTECHNOLOGIA W KOSMETOLOGII SŁAWOMIR WIERZBA

BIOTECHNOLOGIA W KOSMETOLOGII SŁAWOMIR WIERZBA BIOTECHNOLOGIA W KOSMETOLOGII SŁAWOMIR WIERZBA TREŚĆ WYKŁADÓW Budowa i biologia skóry. Typy skóry. Funkcje skóry. Układ odpornościowy skóry. Starzenie się skóry. Przenikanie przez skórę. Absorpcja skórna.

Bardziej szczegółowo

Najnowsze metody analityczne stosowane w analizie specjacyjnej

Najnowsze metody analityczne stosowane w analizie specjacyjnej Najnowsze metody analityczne stosowane w analizie specjacyjnej Danuta Barałkiewicz, Anetta Hanć, Izabela Komorowicz, Karol Sęk Pracownia Analizy Spektroskopowej Pierwiastków, Wydział Chemii, Uniwersytet

Bardziej szczegółowo

Nowoczesne metody analizy pierwiastków

Nowoczesne metody analizy pierwiastków Nowoczesne metody analizy pierwiastków Techniki analityczne Chromatograficzne Spektroskopowe Chromatografia jonowa Emisyjne Absorpcyjne Fluoroscencyjne Spektroskopia mas FAES ICP-AES AAS EDAX ICP-MS Prezentowane

Bardziej szczegółowo

(studia II stopnia) Monitoring i analityka zanieczyszczeń środowiska Temat pracy

(studia II stopnia) Monitoring i analityka zanieczyszczeń środowiska Temat pracy Porównanie modeli matematycznych transportu zanieczyszczeń rozpuszczonych w rzekach. (temat może być realizowany przez 2 osoby) Praca obejmuje implementację i porównanie modeli matematycznych służących

Bardziej szczegółowo

Zakres zastosowań chromatografii wykluczania

Zakres zastosowań chromatografii wykluczania Zakres zastosowań chromatografii wykluczania CHROMATOGRAFIA WYKLUCZANIA (dawniej żelowa PC/SEC) prof. M. Kamiński WCh-PG Gdańsk, 2013 - Badanie rozkładu masy molekularnej różnego typu materiałów polimerów

Bardziej szczegółowo

Instrukcja do ćwiczeń laboratoryjnych

Instrukcja do ćwiczeń laboratoryjnych UNIWERSYTET GDAŃSKI WYDZIAŁ CHEMII Pracownia studencka Katedra Analizy Środowiska Instrukcja do ćwiczeń laboratoryjnych Ćwiczenie nr 1 CHROMATOGRAFIA GAZOWA WPROWADZENIE DO TECHNIKI ORAZ ANALIZA JAKOŚCIOWA

Bardziej szczegółowo

Wymagania dotyczące badania czynników chemicznych w środowisku pracy w normach europejskich. dr Marek Dobecki - IMP Łódź

Wymagania dotyczące badania czynników chemicznych w środowisku pracy w normach europejskich. dr Marek Dobecki - IMP Łódź Wymagania dotyczące badania czynników chemicznych w środowisku pracy w normach europejskich dr Marek Dobecki - IMP Łódź 1 DOSTĘPNE NORMY EUROPEJSKIE: BADANIA POWIETRZA NA STANOWISKACH PRACY PN-EN 689:2002

Bardziej szczegółowo

8.2. Wartość odżywcza produktów spożywczych Czynniki kształtujące wartość odżywczą produktów spożywczych...185

8.2. Wartość odżywcza produktów spożywczych Czynniki kształtujące wartość odżywczą produktów spożywczych...185 SpiS treści 1. Znaczenie nauki o żywieniu człowieka...9 1.1. Cele i zadania nauki o żywieniu...9 1.2. Rozwój nauki o żywieniu człowieka...9 1.3. Problemy żywieniowe Polski i świata...11 1.4. Organizacje

Bardziej szczegółowo

CHARAKTERYSTYKA PRODUKTU LECZNICZEGO 2. SKŁAD JAKOŚCIOWY I ILOŚCIOWY SUBSTANCJI CZYNNYCH

CHARAKTERYSTYKA PRODUKTU LECZNICZEGO 2. SKŁAD JAKOŚCIOWY I ILOŚCIOWY SUBSTANCJI CZYNNYCH CHARAKTERYSTYKA PRODUKTU LECZNICZEGO 1. NAZWA WŁASNA PRODUKTU LECZNICZEGO SOLUVIT N, proszek do sporządzania roztworu do infuzji 2. SKŁAD JAKOŚCIOWY I ILOŚCIOWY SUBSTANCJI CZYNNYCH 1 fiolka zawiera: Substancje

Bardziej szczegółowo

Odkrycie. Patentowanie. Opracowanie procesu chemicznego. Opracowanie procesu produkcyjnego. Aktywność Toksykologia ADME

Odkrycie. Patentowanie. Opracowanie procesu chemicznego. Opracowanie procesu produkcyjnego. Aktywność Toksykologia ADME Odkrycie Patentowanie Opracowanie procesu chemicznego Opracowanie procesu produkcyjnego Aktywność Toksykologia ADME Optymalizacja warunków reakcji Podnoszenie skali procesu Opracowanie specyfikacji produktu

Bardziej szczegółowo

RT31-020, RT , MgCl 2. , random heksamerów X 6

RT31-020, RT , MgCl 2. , random heksamerów X 6 RT31-020, RT31-100 RT31-020, RT31-100 Zestaw TRANSCRIPTME RNA zawiera wszystkie niezbędne składniki do przeprowadzenia syntezy pierwszej nici cdna na matrycy mrna lub całkowitego RNA. Uzyskany jednoniciowy

Bardziej szczegółowo

Deproteinizacja jako niezbędny etap przygotowania próbek biologicznych

Deproteinizacja jako niezbędny etap przygotowania próbek biologicznych Deproteinizacja jako niezbędny etap przygotowania próbek biologicznych Instrukcja do ćwiczeń opracowana w Katedrze Chemii Środowiska Uniwersytetu Łódzkiego. 1. Wstęp Określenie próbka biologiczna jest

Bardziej szczegółowo

ZAKRES AKREDYTACJI LABORATORIUM BADAWCZEGO Nr AB 1525

ZAKRES AKREDYTACJI LABORATORIUM BADAWCZEGO Nr AB 1525 ZAKRES AKREDYTACJI LABORATORIUM BADAWCZEGO Nr AB 1525 wydany przez POLSKIE CENTRUM AKREDYTACJI 01-382 Warszawa, ul. Szczotkarska 42 Wydanie nr 3 Data wydania: 27 maja 2016 r. AB 1525 Nazwa i adres UNIWERSYTET

Bardziej szczegółowo

(Tekst mający znaczenie dla EOG)

(Tekst mający znaczenie dla EOG) 25.11.2014 PL L 337/53 RZPRZĄDZENIE KMISJI (UE) NR 1257/2014 z dnia 24 listopada 2014 r. zmieniające rozporządzenie (WE) nr 2003/2003 Parlamentu Europejskiego i Rady w sprawie nawozów w celu dostosowania

Bardziej szczegółowo

ĆWICZENIE 3: CHROMATOGRAFIA PLANARNA

ĆWICZENIE 3: CHROMATOGRAFIA PLANARNA ĆWICZENIE 3: CHROMATOGRAFIA PLANARNA Chromatografia jest to metoda chemicznej analizy instrumentalnej, w której dokonuje się podziału substancji (w przeciwprądzie) między fazę nieruchomą i fazę ruchomą.

Bardziej szczegółowo

Zanieczyszczenia chemiczne

Zanieczyszczenia chemiczne Zanieczyszczenia chemiczne Zanieczyszczenia w środkach spożywczych Podstawa prawna: Rozporządzenie Komisji (WE) nr 1881/2006 z dnia 19 grudnia 2006 r. ustalające najwyższe dopuszczalne poziomy niektórych

Bardziej szczegółowo

Dziennik Urzędowy Unii Europejskiej

Dziennik Urzędowy Unii Europejskiej 3.7.2015 PL L 174/3 ROZPORZĄDZENIE WYKONAWCZE KOMISJI (UE) 2015/1060 z dnia 2 lipca 2015 r. dotyczące na stosowanie bezwodnej betainy i chlorowodorku betainy jako dodatków paszowych dla wszystkich gatunków

Bardziej szczegółowo

3b 2. przedstawione na poniższych schematach. Uzupełnij obserwacje i wnioski z nich wynikające oraz równanie zachodzącej reakcji.

3b 2. przedstawione na poniższych schematach. Uzupełnij obserwacje i wnioski z nich wynikające oraz równanie zachodzącej reakcji. 3b 2 PAWEŁ ZYCH IMIĘ I NAZWISKO: KLASA: GRUPA A 1. W celu zbadania właściwości sacharozy wykonano dwa doświadczenia, które zostały przedstawione na poniższych schematach. Uzupełnij obserwacje i wnioski

Bardziej szczegółowo

Metody chromatograficzne w chemii i biotechnologii, wykład 6. Łukasz Berlicki

Metody chromatograficzne w chemii i biotechnologii, wykład 6. Łukasz Berlicki Metody chromatograficzne w chemii i biotechnologii, wykład 6 Łukasz Berlicki Techniki elektromigracyjne Elektroforeza technika analityczna polegająca na rozdzielaniu mieszanin związków przez wymuszenie

Bardziej szczegółowo

SPIS TREŚCI OD AUTORÓW... 5

SPIS TREŚCI OD AUTORÓW... 5 SPIS TREŚCI OD AUTORÓW... 5 BIAŁKA 1. Wprowadzenie... 7 2. Aminokwasy jednostki strukturalne białek... 7 2.1. Klasyfikacja aminokwasów... 9 2.1.1. Aminokwasy białkowe i niebiałkowe... 9 2.1.2. Zdolność

Bardziej szczegółowo

IN SELECTED FOOD SAMPLES. Streszczenie -

IN SELECTED FOOD SAMPLES. Streszczenie - * IN SELECTED FOOD SAMPLES Streszczenie - - * - 152 Oznaczenia BB-29 2,4,5-tribromobifenyl BB-52 2,2,4,5 -tetrabromobifenyl BB-49 2,2,5,5 -tetrabromobifenyl BB-101 2,2,4,5,5 -pentabromobifenyl BB-153 2,2,4,4,5,5

Bardziej szczegółowo

OPTYMALNY POZIOM SPOŻYCIA BIAŁKA ZALECANY CZŁOWIEKOWI JANUSZ KELLER STUDIUM PODYPLOMOWE 2011

OPTYMALNY POZIOM SPOŻYCIA BIAŁKA ZALECANY CZŁOWIEKOWI JANUSZ KELLER STUDIUM PODYPLOMOWE 2011 OPTYMALNY POZIOM SPOŻYCIA BIAŁKA ZALECANY CZŁOWIEKOWI JANUSZ KELLER STUDIUM PODYPLOMOWE 2011 DLACZEGO DOROSŁY CZŁOWIEK (O STAŁEJ MASIE BIAŁKOWEJ CIAŁA) MUSI SPOŻYWAĆ BIAŁKO? NIEUSTAJĄCA WYMIANA BIAŁEK

Bardziej szczegółowo

UNIWERSYTET W BIAŁYMSTOKU Wydział Biologiczno-Chemiczny

UNIWERSYTET W BIAŁYMSTOKU Wydział Biologiczno-Chemiczny UNIWERSYTET W BIAŁYMSTOKU Wydział Biologiczno-Chemiczny INSTYTUT CHEMII Prof. dr hab. Beata Godlewska-Żyłkiewicz 15-245 Białystok, ul. K. Ciołkowskiego 1, / fax (85) 7388257; 7470113 e-mail: bgodlew@uwb.edu.pl

Bardziej szczegółowo

WALIDACJA PROCESU MYCIA

WALIDACJA PROCESU MYCIA WALIDACJA PROCESU MYCIA Cleaning Validation Practices Using a One-Pot Processor Pharmaceutical Technology Europe February 2004 Barbara Budnik Maria Pulpińska One-Pot Processor mieszanie granulacja suszenie

Bardziej szczegółowo

Genomic Mini AX Bacteria+ Spin

Genomic Mini AX Bacteria+ Spin Genomic Mini AX Bacteria+ Spin Zestaw o zwiększonej wydajności do izolacji genomowego DNA z bakterii Gram-dodatnich. wersja 1017 100 izolacji Nr kat. 060-100MS Pojemność kolumny do oczyszczania DNA wynosi

Bardziej szczegółowo