Bazy i modele danych

Save this PDF as:
 WORD  PNG  TXT  JPG

Wielkość: px
Rozpocząć pokaz od strony:

Download "Bazy i modele danych"

Transkrypt

1 Bazy i modele danych

2 Przełom XX i XXI wieku to okres dynamicznego rozwoju programów sekwencjonowania genomów: 1995 genom Haemophilus influenzae 1997 genom E. coli 1997 genom drożdży S. cerevisiae 1998 genom nicienia Caenorhabditis elegans 1999 genom Muszki owocowej 2000 genom rzodkiewnika A. thaliana 2001 genom człowieka 2005 genom szympansa 2007 pierwszy indywidualny genom człowieka i wiele innych..

3 Nadeszła era METAGENOMIKI, która zajmuje się uzyskiwaniem i analizą sekwencji genomowych całych populacji a nie pojedynczych organizmów

4 Bioinformatyka (ang. bioinformatics, biocomputing) Termin "bioinformatyka" po raz pierwszy pojawił się w 1989 roku Bioinformatyka jest nauką interdyscyplinarną, która integruje: biologię molekularną, informatykę, matematykę, genetykę, genomikę oraz biochemię Bioinformatyka rozwiązuje problemy nagromadzone w wyniku intensywnego rozwoju nauk przyrodniczych przy użyciu metodologii nauk informatycznych: używa metod komputerowych w celu uzyskania odpowiedzi na pytania biologiczne Oxford English Dictionary definiuje bioinformatykę jako: " Naukę zbierania i analizowania złożonych biologicznych danych takich jak kod genetyczny".

5 Bioinformatyka Podstawowym zadaniem bioinformatyki jest rozpoznawanie in silico reguł kierujących zarządzaniem informacją genetyczną przez komórkę dzięki wzorom obserwowanym w ogromie danych sekwencyjnych przetwarzanie surowych danych o sekwencjach, tworzenie baz danych i zarządzanie bazami danych poszukiwanie, analiza i interpretacja informacji z biologicznych baz danych (analiza sekwencji DNA i białek) tworzenie nowych algorytmów i metod statystycznych do analizy danych biologicznych: struktury, funkcji, ewolucji genów, białek i całych genomów symulacje komputerowe w biochemii i biologii molekularnej inne techniki informatyczne związane z naukami biologicznymi

6 Po co tworzyć biologiczne bazy danych? Napływ danych wymusił rozwój metod analizy gromadzonych danych w celu ich klasyfikacji, a tym samym katalogowanie rodzin białek i charakteryzowanie związków funkcyjnych między nimi obecne kluczowe zjawisko w procesie opisywania nowo poznanych genomów analizy porównawcze Przedstawianie danych sekwencyjnych w szerszym biomedycznym kontekście który z kolei prowadzi do integracji danych z zakresu biologii molekularnej z innymi dziedzinami (bazami): biologią komórki, metabolomiką, medycyną itd.

7 Kiedy powstały pierwsze biologiczne bazy danych? Historycznie bazy danych nukleotydowe są młodsze niż bazy danych sekwencji białkowych 1965 Dayhoff i wsp. Opublikowali Atlas of Protein Sequences and Structures, w którym zawarli wszystkie znane wtedy sekwencje białkowe (pojemność 1 dyskietki) 1980 roku ukazała się baza danych EMBL, potem pojawił się GenBank (1982) a następnie DDBJ.

8

9 Ile jest baz danych (2012): 1380 publicznych baz danych tj. dostępnych on line

10 Ile jest baz danych (2013): 1512 w samym tylko 2012 przybyło 132 nowych dostępnych on line

11 Ile jest baz danych (2014): 1552

12 Ile jest baz danych (2015): nowych związanych z biologią molekularną

13 Ile jest baz danych (2016): 54 nowych związanych z biologią molekularną

14 Bazy danych stają się wysoce specjalistyczne: odziaływania typu białko-białko niekodujące RNA, microrna oraz ich docelowe miejsca działania w komórkach, geny związane z chorobami

15 Podział baz danych przyrodniczych i biomedycznych

16

17

18 Niesekwencyjne bazy danych Bibliograficzne bazy danych

19 Kliniczne bazy danych

20 Metabazy: kojarzą ze sobą rekordy z wielu typów baz The National Center for Biotechnology Information (NCBI)

21 Czym jest GenBank? GenBank jest powszechnie dostępną, internetową sekwencyjną bazą danych, zawierającą sekwencje nukloetydowe, zarządzaną przez National Center for Biotechnology Information (NCBI) w USA. Jest częścią przedsięwzięcia jakim jest międzynarodowa współpraca w tworzeniu bazy danych zawierającej sekwencje nukleotydowe (International Nucleotide Sequence Database Collaboration - INSDC). W ramach tej współpracy trzy instytucje: DNA DataBank of Japan (DDBJ), European Molecular Biology Laboratory (EMBL) oraz GenBank codziennie wymieniają i uzupełniają własne zasoby zgromadzonych sekwencji nukleotydowych poszczególnych genów

22 Dane wymieniane codziennie pomiędzy trzema współpracującymi bazami sekwencji nukleotydowch : GenBank, DNA Database of Japan (DDBJ), European Molecular Biology Laboratory Database (EMBL) NIH Wprowadzanie Aktualizacja CIB NCBI Entrez GenBank EMBL DDBJ EBI Aktualizacja Wprowadzanie NIG getentry Wprowadzanie Aktualizacja SRS EMBL

23 GenBank jest tzw. pierwotną bazą danych Sekwencyjne bazy danych-podział 1. Pierwotne Bazy Danych - Primary Databases (bezpośrednie wyniki eksperymentów, z nielicznymi interpretacjami dane pozornie nieuporządkowane - dość powierzchowne Bezpośrednie wprowadzanie pojedynczych rekordów - Oryginalne wprowadzenia - submissions (BankIt, Sequin) Surowe dane sekwencyjne pochodzące z Centrów Genomowych Obsługa bazy organizuje, ale nie dodaje dodatkowych informacji 2. Pochodne (wtórne) bazy danych - Derivative Databases (uporządkowane zbiory danych) integracja danych z wielu pierwotnych baz nadaje im dodatkowe ważne informacje Nadzorowane przez ludzi Składanie, dodawanie i korekta danych z baz pierwotnych Np.: SWISS-PROT, PIR, NCBI RefSeq, mrna, bazy danych rodzin białkowych Pochodne komputerowe Np.: UniGene Łączone Np.: NCBI Genome Assembly

24 Struktura rekordów w bazach danych Jest ściśle określona dla poszczególnych baz danych Musi być w formacie czytelnym dla człowieka i komputera Zawiera absolutnie unikalny element, które precyzyjnie określa dany rekord kod (numer) dostępu Rekordy w bazach danych są tworzone w oparciu o obowiązujący w danej bazie model danych

25 Model danych NCBI: Rekord bazy GenBank jest rekordem opartym na DNA Pozostałe dane tego modelu tj. translacja regionu kodującego w DNA (o ile występuje) sekwencja białka, cytowania bibliograficzne, struktury trójwymiarowe białka, powiązania taksonomiczne oraz ewentualne powiązania do map genomów stanowią element dodatkowy, który jak najpełniej stara się opisać sekwencję DNA Korzyści takiego modelu danych: Możliwość integracji programów do przeszukiwania baz danych i samych baz danych Możliwość wygodnego śledzenia informacji od sekwencji DNA, jej lokalizacji na mapie chromosomowej do kodowanego białka, jego trójwymiarowego obrazu oraz opublikowanej na dany temat literatur Powiązania plików (białko, cytowanie, struktura) z sekwencją DNA wzbogaca model danych i ułatwia potencjalne nowe odkrycia Łatwość rozszerzania modelu o kolejne powiązania w miarę ich powstawania bez konieczności nieustannej konwersji formatów

26 Rekord GenBank

27 Rekord GenBanku Podstawową jednostką informacji bazy danych GenBank jest GBFF (GenBank Flat File) GBBF składa się z 3 podstawowych części: LOCUS AF bp mrna INV 02-MAR-2000 DEFINITION Limulus polyphemus myosin III mrna, complete cds. ACCESSION AF VERSION AF GI: KEYWORDS. SOURCE Atlantic horseshoe crab. ORGANISM Limulus polyphemus Eukaryota; Metazoa; Arthropoda; Chelicerata; Merostomata; Xiphosura; Limulidae; Limulus. REFERENCE 1 (bases 1 to 3808) AUTHORS Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., Greenberg,R.M. and Smith,W.C. TITLE A myosin III from Limulus eyes is a clock-regulated phosphoprotein JOURNAL J. Neurosci. (1998) In press REFERENCE 2 (bases 1 to 3808) AUTHORS Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., Greenberg,R.M. and Smith,W.C. TITLE Direct Submission JOURNAL Submitted (29-APR-1998) Whitney Laboratory, University of Florida, 9505 Ocean Shore Blvd., St. Augustine, FL 32086, USA REFERENCE 3 (bases 1 to 3808) AUTHORS Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., Greenberg,R.M. and Smith,W.C. TITLE Direct Submission JOURNAL Submitted (02-MAR-2000) Whitney Laboratory, University of Florida, 9505 Ocean Shore Blvd., St. Augustine, FL 32086, USA REMARK Sequence update by submitter COMMENT On Mar 2, 2000 this sequence version replaced gi: Nagłówek

28 Rekord GenBanku, cd. FEATURES Location/Qualifiers source /organism="limulus polyphemus" /db_xref="taxon:6850" /tissue_type="lateral eye" CDS /note="n-terminal protein kinase domain; C-terminal myosin heavy chain head; substrate for PKA" /codon_start=1 /product="myosin III" /protein_id="aac " /db_xref="gi: " /translation="meykcisehlpfetlpdpgdrfevqelvgtgtyatvysaidkqa NKKVALKIIGHIAENLLDIETEYRIYKAVNGIQFFPEFRGAFFKRGERESDNEVWLGI EFLEEGTAADLLATHRRFGIHLKEDLIALIIKEVVRAVQYLHENSIIHRDIRAANIMF SKEGYVKLIDFGLSASVKNTNGKAQSSVGSPYWMAPEVISCDCLQEPYNYTCDVWSIG ITAIELADTVPSLSDIHALRAMFRINRNPPPSVKRETRWSETLKDFISECLVKNPEYR PCIQEIPQHPFLAQVEGKEDQLRSELVDILKKNPGEKLRNKPYNVTFKNGHLKTISGQ BASE COUNT 1201 a 689 c 782 g 1136 t ORIGIN 1 tcgacatctg tggtcgcttt ttttagtaat aaaaaattgt attatgacgt cctatctgtt 2. Tabela cech 3. Sekwencja // 3781 aagatacagt aactagggaa aaaaaaaa GBFF jest formą w jakiej wymieniane są dane pomiędzy GenBank, EMBL, DDBJ

29 Struktura rekordu w GenBanku 1. Nagłówek: część rekordu charakterystyczna dla bazy danych Pierwszy wiersz nagłówka we wszystkich GBFF to wiersz LOCUS Nazwa Locus (dawniej oznaczała faktyczną nazwę locus którego dotyczył np. HUMBG) GB Division (dawniej miało znaczenie taksonomiczne) LOCUS AF bp mrna INV 02-MAR-2000 Długość sekwencji Typ cząsteczki mrna (= cdna) rrna snrna DNA Data wprowadzenia lub modyfikacji

30 Nagłówek c.d. DEFINITION Limulus polyphemus myosin III mrna, complete cds. wiersz definicji - tytuł podsumowuje informację biologiczną rekordu ACCESSION AF Accession Number (kod dostępu) Zapisywany jako 1+5 albo 2+6 VERSION AF GI: Wersja Accession, Historia aktualizacji Numer gi (kolejny numer rekordu w bazie danych) (znika z rekordów od )

31 Nagłówek c.d. Słowa Kluczowe Nazwa zwyczajowa Nazwa gatunkowa KEYWORDS. SOURCE Atlantic horseshoe crab. ORGANISM Limulus polyphemus Eukaryota; Metazoa; Arthropoda; Chelicerata; Merostomata; Xiphosura; Limulidae; Limulus. Powiązania taxonomiczne według GenBanku

32 Nagłówek c.d. Odnośniki literaturowe REFERENCE 1 (bases 1 to 3808) AUTHORS Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., Greenberg,R.M. and Smith,W.C. TITLE A myosin III from Limulus eyes is a clock-regulated phosphoprotein JOURNAL J. Neurosci. (1998) In press REFERENCE 2 (bases 1 to 3808) AUTHORS Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., Greenberg,R.M. and Smith,W.C. TITLE Direct Submission JOURNAL Submitted (29-APR-1998) Whitney Laboratory, University of Florida, 9505 Ocean Shore Blvd., St. Augustine, FL 32086, USA REFERENCE 3 (bases 1 to 3808) AUTHORS Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., Greenberg,R.M. and Smith,W.C. TITLE Direct Submission JOURNAL Submitted (02-MAR-2000) Whitney Laboratory, University of Florida, 9505 Ocean Shore Blvd., St. Augustine, FL 32086, USA REMARK Sequence update by submitter COMMENT On Mar 2, 2000 this sequence version replaced gi:

33 2. Tabela Cech środkowy segment GBFF Cecha: źródło biologiczne -pochodzenie materiału genetycznego, Cecha: sekwencja kodująca białko (jeśli DNA koduje białko) FEATURES Location/Qualifiers source /organism="limulus polyphemus" /db_xref="taxon:6850" /tissue_type="lateral eye" CDS /note="n-terminal protein kinase domain; C-terminal myosin heavy chain head; substrate for PKA" /codon_start=1 /product="myosin III" /protein_id="aac " /db_xref="gi: " /translation="meykcisehlpfetlpdpgdrfevqelvgtgtyatvysaidk NKKVALKIIGHIAENLLDIETEYRIYKAVNGIQFFPEFRGAFFKRGERESDNEVWL " Jeśli DNA koduje białko pojawiają się dodatkowe informacje tzw. kwalifikatory -rodzaj kodu genetycznego -faza (ramka )odczytu kodonów odnośniki krzyżowe do bazy danych sekwencji białkowych

34 3. Sekwencja Statystyka składu sekwencji nt Początek podawania sekwencji BASE COUNT 1201 a 689 c 782 g 1136 t ORIGIN 1 tcgacatctg tggtcgcttt ttttagtaat aaaaaattgt attatgacgt cctatctgtt <opuszczona sekwencja> 3721 accaatgtta taatatgaaa tgaaataaag cagtcatggt agcagtggct gtttgaaata 3781 aagatacagt aactagggaa aaaaaaaa // Znak: koniec rekordu

35

36 Format EMBL Numer dostępu OPIS

37 Odnośniki literaturowe Tabela cech: Nazwa organizmu, taksonomia, ramka odczytu itp. Odsyłacze (odnośniki krzyżowe) do rekordów innych baz powiązanych z tą sekwencją

38

39 Format Fasta maksymalnie uproszczona wersja rekordu Numer w bazie Identyfikator bazy danych: gb oznacza Opis rekordu i nazwa genu GenBank Kod dostępu >gi gb DQ Rhizobium leguminosarum bv. trifolii strain TA1 lipid A oxidase (lpxq) gene, complete cds AAAAGCCATATGCCGTCGAGGGCAAGGTCAGCTGCGGCACCAAATAGCGCCGCAGCCGAAATTTACTCTT ACCAGTGGAACGATACGCCGACGTTGACGGCATTCGTGAAGATGTTGGTCTTCAGGTCCACGCCGCTATC GATCGGAACGTCGATGCGCGAATAGGTGCCCTTGTATTCGACGAAGGTCGACCAGCGCTCGGTCACCTTG AAGTCGACGCCGGCCTGGGCCTGCAGCGTCACGCCGCCGAATTCATAAGCCCAGGTCTTGCCCTCAGGGC GAATCACTTCGACATGCGGAATGTTCACGCCGATGCCGGCGCCGAGATAGGGCGTCCAGCGGCGGGTCGG ATCCTGGAAGCGATAGAGACCGTTCACCGTGATGAGGTTCAGGCCGTCGGTGAATTCGAAATGCGACCAG CCGGTCTTGGCCAGCGTATCGTCGTCGGCATAGACCTTGTCATGGGTATAATCGAGCGAGATACCCCAGT TCGGTTTGTTGAAGTTCTCGAGCCACCAGGTGACGCGGCCGCCGTAATAAGGCGGGCTGCCGAAGGACTT GCCTTCCCAGCCGGCGGTGAAATGCGTGCCGTCGGAGAGATCGACGCCGCTGTGTGGTGCGGTCTGATAG CCGCCGTAGACGGAGAATTGCAGATCTTCCGCCGAGGCGGAAGCTGCCGAACAGATGGTGAAAAACGCGA TGCCCGCAAGCAGTGAAGCGGAGGAACGCAGCGCATATGTCATTGAATAGCCCCGATATTGCAAATGTGT CGACTCTTAGGCAGGTTTGCCAGCTTTTGGCCGCAAAGTCTAAGCAAAACAAAAGGCGCGTCAAATGCGC

Bioinformatyka. Michał Bereta mbereta@pk.edu.pl www.michalbereta.pl

Bioinformatyka. Michał Bereta mbereta@pk.edu.pl www.michalbereta.pl Bioinformatyka Michał Bereta mbereta@pk.edu.pl www.michalbereta.pl 1 Bazy danych biologicznych Bazy danych sekwencji nukleotydowych Pierwotne bazy danych (ang. primary database) Wykorzystywane do zbierania

Bardziej szczegółowo

Bioinformatyczne bazy danych

Bioinformatyczne bazy danych Bioinformatyczne bazy danych Czym jest bioinformatyka? Bioinformatyka jest nauką integrującą różne dziedziny wiedzy Gruca (2010) Czym jest bioinformatyka? Bioinformatyka obejmuje technologie wykorzystujące

Bardziej szczegółowo

Bioinformatyka. Wykład 2 (12.X.2010) I r. studiów magisterskich, biologia (SGGW) Krzysztof Pawłowski

Bioinformatyka. Wykład 2 (12.X.2010) I r. studiów magisterskich, biologia (SGGW) Krzysztof Pawłowski Bioinformatyka Wykład 2 (12.X.2010) I r. studiów magisterskich, biologia (SGGW) Krzysztof Pawłowski tydzień temu Co to jest bioinformatyka Sekwencjonowanie genomów historia Metagenomika Wykład 2 spis treści

Bardziej szczegółowo

Możliwości współczesnej inżynierii genetycznej w obszarze biotechnologii

Możliwości współczesnej inżynierii genetycznej w obszarze biotechnologii Możliwości współczesnej inżynierii genetycznej w obszarze biotechnologii 1. Technologia rekombinowanego DNA jest podstawą uzyskiwania genetycznie zmodyfikowanych organizmów 2. Medycyna i ochrona zdrowia

Bardziej szczegółowo

BIOINFORMATYKA BIOLOGICZNE BAZY DANYCH

BIOINFORMATYKA BIOLOGICZNE BAZY DANYCH http://theta.edu.pl/ Podstawy Bioinformatyki II BIOINFORMATYKA BIOLOGICZNE BAZY DANYCH 1 Czym jest bioinformatyka? 2 Bioinformatyka Bioinformatyka jest interdyscyplinarną dziedziną nauki obejmującą wykorzystanie

Bardziej szczegółowo

BIOLOGICZNE BAZY DANYCH SYLABUS

BIOLOGICZNE BAZY DANYCH SYLABUS BIOLOGICZNE BAZY DANYCH SYLABUS Elementy składowe sylabusu Nazwa jednostki prowadzącej kierunek Nazwa kierunku studiów Poziom kształcenia Profil studiów Forma studiów Kod Język Rodzaj Rok studiów /semestr

Bardziej szczegółowo

Podstawy bioinformatyki - biologiczne bazy danych

Podstawy bioinformatyki - biologiczne bazy danych Podstawy bioinformatyki - biologiczne bazy danych Czym jest bioinformatyka? Bioinformatyka Bioinformatyka jest interdyscyplinarną dziedziną nauki obejmującą wykorzystanie metod obliczeniowych do badania

Bardziej szczegółowo

Jest to dziedzina biologiczna wywodząca się z biotechnologii. Bioinformatyka

Jest to dziedzina biologiczna wywodząca się z biotechnologii. Bioinformatyka Wstęp do obsługi biologicznych baz danych i analizy porównawczej białek i genów Katedra Fizjologii i Biotechnologii Roślin Pok. 113 CB jan.jastrzebski@uwm.edu.pl bioinformatyka@gmail.com www.ebiology.net

Bardziej szczegółowo

Bioinformatyczne bazy danych - część 2. -przeszukiwanie baz danych -pobieranie danych

Bioinformatyczne bazy danych - część 2. -przeszukiwanie baz danych -pobieranie danych Bioinformatyczne bazy danych - część 2 -przeszukiwanie baz danych -pobieranie danych Numery dostępowe baz danych (accession number) to ciąg liter i cyfr służących jako etykieta identyfikująca sekwencję

Bardziej szczegółowo

Bioinformatyka. Bazy danych. Wykład 3. E. Banachowicz. Wykład monograficzny Bioinformatyka. Wykład 3, Zakład Biofizyki Molekularnej IF UAM

Bioinformatyka. Bazy danych. Wykład 3. E. Banachowicz. Wykład monograficzny Bioinformatyka. Wykład 3, Zakład Biofizyki Molekularnej IF UAM Bioinformatyka Wykład 3. E. Banachowicz Zakład Biofizyki Molekularnej IF UAM http://www.amu.edu.pl/~ewas Bazy danych Wykład 3, 2008 1 Niesekwencyjne BazyDanych bibliograficzne kliniczne ścieżek metabolicznych

Bardziej szczegółowo

Nowoczesne systemy ekspresji genów

Nowoczesne systemy ekspresji genów Nowoczesne systemy ekspresji genów Ekspresja genów w organizmach żywych GEN - pojęcia podstawowe promotor sekwencja kodująca RNA terminator gen Gen - odcinek DNA zawierający zakodowaną informację wystarczającą

Bardziej szczegółowo

PODSTAWY BIOINFORMATYKI

PODSTAWY BIOINFORMATYKI PODSTAWY BIOINFORMATYKI Prowadzący: JOANNA SZYDA ADRIAN DROśDś WSTĘP 1. Katedra Genetyki badania bioinformatyczne 2. Tematyka przedmiotu 3. Charakterystyka wykładów 4. Charakterystyka ćwiczeń 5. Informacje

Bardziej szczegółowo

ISBN 978-83-89244-90-1

ISBN 978-83-89244-90-1 ISBN 978-83-89244-90-1 9 788389 244901 Notka biograficzna Aleksandra Gruca jest inżynierem, bioinformatykiem. Od początku swojej pracy naukowej koncentruje się na zagadnieniach związanych z zastosowaniem

Bardziej szczegółowo

Kontakt.

Kontakt. BIOINFORMATYKA i BIOLOGIA OBLICZENIOWA Kontakt Małgorzata.Kotulska@pwr.edu.pl Katedra Inżynierii Biomedycznej WPPT http://www.kotulska-lab.pwr.wroc.pl/forstudents/ D1 pok. 115 Konsultacje : czwartek 17.05-18.55

Bardziej szczegółowo

Spis treści. Przedmowa... XI. Wprowadzenie i biologiczne bazy danych. 1 Wprowadzenie... 3. 2 Wprowadzenie do biologicznych baz danych...

Spis treści. Przedmowa... XI. Wprowadzenie i biologiczne bazy danych. 1 Wprowadzenie... 3. 2 Wprowadzenie do biologicznych baz danych... Przedmowa... XI Część pierwsza Wprowadzenie i biologiczne bazy danych 1 Wprowadzenie... 3 Czym jest bioinformatyka?... 5 Cele... 5 Zakres zainteresowań... 6 Zastosowania... 7 Ograniczenia... 8 Przyszłe

Bardziej szczegółowo

Od jakiego pułapu startujemy? matematyka

Od jakiego pułapu startujemy? matematyka dla biotechnologów Wykład 2 Definicja bioinformatyki Od jakiego pułapu startujemy? Zakładamy, że te pojęcia są w małym palcu: DNA, RNA struktura, funkcje, rodzaje Genom Białka struktury, funkcje, rodzaje,

Bardziej szczegółowo

10/9/2013. Bioinformatyka i Biologia Obliczeniowa. BIOINFORMATYKA Co to jest i po co? Czym będziemy zajmować się na kursie: Tematyka wykładu

10/9/2013. Bioinformatyka i Biologia Obliczeniowa. BIOINFORMATYKA Co to jest i po co? Czym będziemy zajmować się na kursie: Tematyka wykładu Bioinformatyka i Biologia Obliczeniowa Małgorzata.Kotulska@pwr.wroc.pl Instytut InŜynierii Biomedycznej i Pomiarowej D1 pok. 115 Konsultacje: czwartek: godz. 9-11 wtorek 9-11 (preferowane info emailowe

Bardziej szczegółowo

Podstawy biologiczne - komórki. Podstawy biologiczne - cząsteczki. Model komórki eukariotycznej. Wprowadzenie do Informatyki Biomedycznej

Podstawy biologiczne - komórki. Podstawy biologiczne - cząsteczki. Model komórki eukariotycznej. Wprowadzenie do Informatyki Biomedycznej Wprowadzenie do Informatyki Biomedycznej Wykład 1: Podstawy bioinformatyki Wydział Informatyki PB Podstawy biologiczne - komórki Wszystkie organizmy zbudowane są z komórek komórka jest skomplikowanym systemem

Bardziej szczegółowo

BIOINFORMATYKA. edycja 2015. wykład 2 BAZY DANYCH. dr Jacek Śmietański jacek.smietanski@ii.uj.edu.pl http://jaceksmietanski.net.

BIOINFORMATYKA. edycja 2015. wykład 2 BAZY DANYCH. dr Jacek Śmietański jacek.smietanski@ii.uj.edu.pl http://jaceksmietanski.net. BIOINFORMATYKA edycja 2015 wykład 2 BAZY DANYCH dr Jacek Śmietański jacek.smietanski@ii.uj.edu.pl http://jaceksmietanski.net slajd 1 Tło: mioglobina Myoglobin was the first protein visualized in three

Bardziej szczegółowo

Ćwiczenia nr 5. Wykorzystanie baz danych i narzędzi analitycznych dostępnych online

Ćwiczenia nr 5. Wykorzystanie baz danych i narzędzi analitycznych dostępnych online Techniki molekularne ćw. 5 1 z 13 Ćwiczenia nr 5. Wykorzystanie baz danych i narzędzi analitycznych dostępnych online I. Zasoby NCBI Strona: http://www.ncbi.nlm.nih.gov/ stanowi punkt startowy dla eksploracji

Bardziej szczegółowo

Podstawy bioinformatyki dla biotechnologów. plan. Od jakiego pułapu startujemy? Wykład 2. Definicja bioinformatyki

Podstawy bioinformatyki dla biotechnologów. plan. Od jakiego pułapu startujemy? Wykład 2. Definicja bioinformatyki dla biotechnologów Wykład 2 Definicja bioinformatyki Wykład 2 plan Sprawy organizacyjne Definicje bioinformatyki Miejsce i dziedziny bioinformatyki Projekty bioinformatyczne Wykład 2 / 2 Od jakiego pułapu

Bardziej szczegółowo

Bioinformatyka. z sylabusu...

Bioinformatyka. z sylabusu... Bioinformatyka Wykład 1. E. Banachowicz Zakład Biofizyki Molekularnej IF UAM http://www.amu.edu.pl/~ewas z sylabusu... Wykład 1, 2010/2011 1 Orientacyjny plan wykładów 1. Przegląd baz danych, formaty danych

Bardziej szczegółowo

Bioinformatyka. Rodzaje Mutacji

Bioinformatyka. Rodzaje Mutacji Bioinformatyka (wykład monograficzny) wykład 3. E. Banachowicz Zakład Biofizyki Molekularnej IF UAM http://www.amu.edu.pl/~ewas Rodzaje Mutacji zmienność sekwencji (sequence variation) mutacje polimorfizm

Bardziej szczegółowo

wykład dla studentów II roku biotechnologii Andrzej Wierzbicki

wykład dla studentów II roku biotechnologii Andrzej Wierzbicki Genetyka ogólna wykład dla studentów II roku biotechnologii Andrzej Wierzbicki Uniwersytet Warszawski Wydział Biologii andw@ibb.waw.pl http://arete.ibb.waw.pl/private/genetyka/ Budowa rybosomu Translacja

Bardziej szczegółowo

Historia Bioinformatyki

Historia Bioinformatyki Historia Bioinformatyki 1859 Darwin i Wallace opublikowali O powstaniu gatunku 1865 Mendel eksperymentując z grochem, wykazuje, że cechy dziedziczą się w odrębnych jednostkach 1869 Meischer wyizolował

Bardziej szczegółowo

Database resources of the National Center for Biotechnology Information. Magdalena Malczyk

Database resources of the National Center for Biotechnology Information. Magdalena Malczyk Database resources of the National Center for Biotechnology Information Magdalena Malczyk NCBI NCBI = National Center for Biotechnology Information Założone w 1998 r. Cel: rozwijanie systemów informatycznych

Bardziej szczegółowo

Informatyka w medycynie Punkt widzenia kardiologa

Informatyka w medycynie Punkt widzenia kardiologa Informatyka w medycynie Punkt widzenia kardiologa Lech Poloński Mariusz Gąsior Informatyka medyczna Dział informatyki zajmujący się jej zastosowaniem w ochronie zdrowia (medycynie) Stymulacja rozwoju informatyki

Bardziej szczegółowo

Wprowadzenie do bioinformatyki

Wprowadzenie do bioinformatyki Metody bioinformatyki Wprowadzenie do bioinformatyki prof. dr hab. Jan Mulawka Czym jest bioinformatyka Bioinformatyka to dyscyplina zajmująca się stosowaniem narzędzi matematycznych i informatycznych

Bardziej szczegółowo

Rozdział 1 Wprowadzenie do baz danych. (c) Instytut Informatyki Politechniki Poznańskiej 1

Rozdział 1 Wprowadzenie do baz danych. (c) Instytut Informatyki Politechniki Poznańskiej 1 Rozdział 1 Wprowadzenie do baz danych 1 Model danych 2 Funkcje systemu zarządzania bazą danych Wymagania spójność bazy danych po awarii trwałość danych wielodostęp poufność danych wydajność rozproszenie

Bardziej szczegółowo

Bioinformatyka Laboratorium, 30h. Michał Bereta

Bioinformatyka Laboratorium, 30h. Michał Bereta Laboratorium, 30h Michał Bereta mbereta@pk.edu.pl www.michalbereta.pl Zasady zaliczenia przedmiotu Kolokwia (3 4 ) Ocena aktywności i przygotowania Obecność Literatura, materiały Bioinformatyka i ewolucja

Bardziej szczegółowo

Dr. habil. Anna Salek International Bio-Consulting 1 Germany

Dr. habil. Anna Salek International Bio-Consulting 1 Germany 1 2 3 Drożdże są najprostszymi Eukariontami 4 Eucaryota Procaryota 5 6 Informacja genetyczna dla każdej komórki drożdży jest identyczna A zatem każda komórka koduje w DNA wszystkie swoje substancje 7 Przy

Bardziej szczegółowo

BIOINFORMATYKA. edycja 2016 / wykład 11 RNA. dr Jacek Śmietański

BIOINFORMATYKA. edycja 2016 / wykład 11 RNA. dr Jacek Śmietański BIOINFORMATYKA edycja 2016 / 2017 wykład 11 RNA dr Jacek Śmietański jacek.smietanski@ii.uj.edu.pl http://jaceksmietanski.net Plan wykładu 1. Rola i rodzaje RNA 2. Oddziaływania wewnątrzcząsteczkowe i struktury

Bardziej szczegółowo

Księgarnia PWN: A.D. Baxevanis, B.F.F. Ouellette Bioinformatyka

Księgarnia PWN: A.D. Baxevanis, B.F.F. Ouellette Bioinformatyka Księgarnia PWN: A.D. Baxevanis, B.F.F. Ouellette Bioinformatyka Słowo wstępne XIII Przedmowa XV 1. Bioinformatyka i Internet Andreas D. Baxevanis 1 1.1. Podstawy Internetu 2 1.2. Połączenie z Internetem

Bardziej szczegółowo

Bioinformatyka. Michał Przyłuski

Bioinformatyka. Michał Przyłuski Bioinformatyka Michał Przyłuski Plan prezentacji Wstęp biologiczny Biologia molekularna genetyka Bioinformatyka Przykłady zastosowań: sekwencjonowanie mikromacierze filogenetyka Czemu wstęp biologiczny?

Bardziej szczegółowo

Zaoczne Liceum Ogólnokształcące Pegaz

Zaoczne Liceum Ogólnokształcące Pegaz WYMAGANIA EGZAMINACYJNE ROK SZKOLNY 2015/2016 Semestr jesienny TYP SZKOŁY: liceum ogólnokształcące PRZEDMIOT: biologia SEMESTR: II LICZBA GODZIN W SEMESTRZE: 15 PROGRAM NAUCZANIA: Program nauczania biologii

Bardziej szczegółowo

Geny i działania na nich

Geny i działania na nich Metody bioinformatyki Geny i działania na nich prof. dr hab. Jan Mulawka Trzy królestwa w biologii Prokaryota organizmy, których komórki nie zawierają jądra, np. bakterie Eukaryota - organizmy, których

Bardziej szczegółowo

Generator testów Bioinformatyka wer / 0 Strona: 1

Generator testów Bioinformatyka wer / 0 Strona: 1 Przedmiot: Nazwa przedmiotu Nazwa testu: Bioinformatyka wer. 1.0.6 Nr testu 0 Klasa: V zaoczne WNB UZ Odpowiedzi zaznaczamy TYLKO w tabeli! 1. Analiza porównawcza białek zwykle zaczyna się na badaniach

Bardziej szczegółowo

Ewolucja molekularna człowieka okiem bioinformatyka. Justyna Wojtczak Jarosław Jeleniewicz

Ewolucja molekularna człowieka okiem bioinformatyka. Justyna Wojtczak Jarosław Jeleniewicz Ewolucja molekularna człowieka okiem bioinformatyka Justyna Wojtczak Jarosław Jeleniewicz Informatyka w biologii - bioinformatyka Jest to szeroka dziedzina zajmująca się tworzeniem zaawansowanych baz danych,

Bardziej szczegółowo

października 2013: Elementarz biologii molekularnej. Wykład nr 2 BIOINFORMATYKA rok II

października 2013: Elementarz biologii molekularnej. Wykład nr 2 BIOINFORMATYKA rok II 10 października 2013: Elementarz biologii molekularnej www.bioalgorithms.info Wykład nr 2 BIOINFORMATYKA rok II Komórka: strukturalna i funkcjonalne jednostka organizmu żywego Jądro komórkowe: chroniona

Bardziej szczegółowo

"Zapisane w genach, czyli Python a tajemnice naszego genomu."

Zapisane w genach, czyli Python a tajemnice naszego genomu. "Zapisane w genach, czyli Python a tajemnice naszego genomu." Dr Kaja Milanowska Instytut Biologii Molekularnej i Biotechnologii UAM VitaInSilica sp. z o.o. Warszawa, 9 lutego 2015 Dane biomedyczne 1)

Bardziej szczegółowo

Techniki biologii molekularnej Kod przedmiotu

Techniki biologii molekularnej Kod przedmiotu Techniki biologii molekularnej - opis przedmiotu Informacje ogólne Nazwa przedmiotu Techniki biologii molekularnej Kod przedmiotu 13.9-WB-BMD-TBM-W-S14_pNadGenI2Q8V Wydział Kierunek Wydział Nauk Biologicznych

Bardziej szczegółowo

Rok akademicki: 2014/2015 Kod: EIB-2-206-BN-s Punkty ECTS: 3. Kierunek: Inżynieria Biomedyczna Specjalność: Bionanotechnologie

Rok akademicki: 2014/2015 Kod: EIB-2-206-BN-s Punkty ECTS: 3. Kierunek: Inżynieria Biomedyczna Specjalność: Bionanotechnologie Nazwa modułu: Genetyka molekularna Rok akademicki: 2014/2015 Kod: EIB-2-206-BN-s Punkty ECTS: 3 Wydział: Elektrotechniki, Automatyki, Informatyki i Inżynierii Biomedycznej Kierunek: Inżynieria Biomedyczna

Bardziej szczegółowo

Budowa kwasów nukleinowych

Budowa kwasów nukleinowych Bioinformatyka (wykład monograficzny) wykład 2. E. Banachowicz Zakład Biofizyki Molekularnej IF UAM http://www.amu.edu.pl/~ewas Budowa kwasów nukleinowych Kwasy nukleinowe (DA i RA) zbudowane są z nukleotydów

Bardziej szczegółowo

Bioinformatyka. Krzysztof Pawłowski. wykłady dla I r. studiów magisterskich, biologia (SGGW) 2012 / 2013

Bioinformatyka. Krzysztof Pawłowski. wykłady dla I r. studiów magisterskich, biologia (SGGW) 2012 / 2013 Bioinformatyka wykłady dla I r. studiów magisterskich, biologia (SGGW) 2012 / 2013 Krzysztof Pawłowski Wykład 8.X.2012 Co to jest bioinformatyka? Program wykładów Zastosowanie bioinformatyki: sekwencjonowanie

Bardziej szczegółowo

BUDOWA I FUNKCJA GENOMU LUDZKIEGO

BUDOWA I FUNKCJA GENOMU LUDZKIEGO BUDOWA I FUNKCJA GENOMU LUDZKIEGO Magdalena Mayer Katedra i Zakład Genetyki Medycznej UM w Poznaniu 1. Projekt poznania genomu człowieka: Cele programu: - skonstruowanie szczegółowych map fizycznych i

Bardziej szczegółowo

BIOTECHNOLOGIA MEDYCZNA

BIOTECHNOLOGIA MEDYCZNA BIOTECHNOLOGIA MEDYCZNA K WBT BT2 101 Genomika funkcjonalna 30 4 WBT BT350 In vivo veritas praktikum pracy ze zwierzętami laboratoryjnymi 60 4 Mechanisms of cell trafficking from leucocyte homing to WBT

Bardziej szczegółowo

Analizy DNA in silico - czyli czego można szukać i co można znaleźć w sekwencjach nukleotydowych???

Analizy DNA in silico - czyli czego można szukać i co można znaleźć w sekwencjach nukleotydowych??? Analizy DNA in silico - czyli czego można szukać i co można znaleźć w sekwencjach nukleotydowych??? Alfabet kwasów nukleinowych jest stosunkowo ubogi!!! Dla sekwencji DNA (RNA) stosuje się zasadniczo*

Bardziej szczegółowo

Bioinformatyka Laboratorium, 30h. Michał Bereta mbereta@pk.edu.pl www.michalbereta.pl

Bioinformatyka Laboratorium, 30h. Michał Bereta mbereta@pk.edu.pl www.michalbereta.pl Laboratorium, 30h Michał Bereta mbereta@pk.edu.pl www.michalbereta.pl Zasady zaliczenia przedmiotu Kolokwia (3 4 ) Ocena aktywności i przygotowania Obecnośd Literatura, materiały Bioinformatyka i ewolucja

Bardziej szczegółowo

Generator testów 1.3.1 Bioinformatyka_zdalne wer. 1.0.13 / 0 Strona: 1

Generator testów 1.3.1 Bioinformatyka_zdalne wer. 1.0.13 / 0 Strona: 1 Przedmiot: Bioinformatyka Nazwa testu: Bioinformatyka_zdalne wer. 1.0.13 Nr testu 0 Klasa: WNB UZ Odpowiedzi zaznaczamy TYLKO w tabeli! 1. Model Markowa substytucji aminokwasów w mutagenezie białek zakłada...

Bardziej szczegółowo

KARTA PRZEDMIOTU. (pieczęć wydziału)

KARTA PRZEDMIOTU. (pieczęć wydziału) (pieczęć wydziału) KARTA PRZEDMIOTU 1. Nazwa przedmiotu: Eksploracja danych w bioinformatyce 2. Kod przedmiotu: EksDaBio 3. Karta przedmiotu ważna od roku akademickiego: 2017/2018 4. Forma kształcenia:

Bardziej szczegółowo

Bioinformatyka. Formaty danych - GenBank

Bioinformatyka. Formaty danych - GenBank Bioinformatyka Wykład 4. E. Banachowicz Zakład Biofizyki Molekularnej IF UAM http://www.amu.edu.pl/~ewas Formaty danych - GenBank Poco wprowadza się dane do komputerów? 1. żeby je pobrać 2. żeby coś odkryć

Bardziej szczegółowo

Analizy DNA in silico - czyli czego można szukać i co można znaleźć w sekwencjach nukleotydowych???

Analizy DNA in silico - czyli czego można szukać i co można znaleźć w sekwencjach nukleotydowych??? Analizy DNA in silico - czyli czego można szukać i co można znaleźć w sekwencjach nukleotydowych??? Alfabet kwasów nukleinowych jest stosunkowo ubogi!!! Dla sekwencji DNA (RNA) stosuje się zasadniczo*

Bardziej szczegółowo

PODSTAWY BIOINFORMATYKI 6 BAZA DANYCH NCBI - II

PODSTAWY BIOINFORMATYKI 6 BAZA DANYCH NCBI - II PODSTAWY BIOINFORMATYKI 6 BAZA DANYCH NCBI - II BAZA DANYCH NCBI 1. NCBI 2. Dane gromadzone przez NCBI 3. Przegląd baz danych NCBI: Publikacje naukowe Projekty analizy genomów OMIM: fenotypy człowieka

Bardziej szczegółowo

Wyszukiwanie podobnych sekwencji w bazach danych. Wyszukiwanie w sekwencji nukleotydów czy aminokwasów? Czułość i selektywność

Wyszukiwanie podobnych sekwencji w bazach danych. Wyszukiwanie w sekwencji nukleotydów czy aminokwasów? Czułość i selektywność Wersja 1.05 Wprowadzenie do Informatyki Biomedycznej Wykład 3: Wyszukiwanie w bazach sekwencji Przewidywanie genów Wydział Informatyki PB Marek Krętowski pokój 206 e-mail: m.kretowski@pb.edu.pl http://aragorn.pb.bialystok.pl/~mkret

Bardziej szczegółowo

UCHWAŁA Nr 31/2014 Senatu Uniwersytetu Wrocławskiego z dnia 26 marca 2014 r.

UCHWAŁA Nr 31/2014 Senatu Uniwersytetu Wrocławskiego z dnia 26 marca 2014 r. UCHWAŁA Nr 31/2014 Senatu Uniwersytetu Wrocławskiego z dnia 26 marca 2014 r. w sprawie utworzenia kierunku genetyka i biologia eksperymentalna - studia pierwszego stopnia oraz zmieniająca uchwałę w sprawie

Bardziej szczegółowo

SCENARIUSZ LEKCJI BIOLOGII Z WYKORZYSTANIEM FILMU

SCENARIUSZ LEKCJI BIOLOGII Z WYKORZYSTANIEM FILMU SCENARIUSZ LEKCJI BIOLOGII Z WYKORZYSTANIEM FILMU Czy priony zawsze są szkodliwe? SPIS TREŚCI: Wprowadzenie. Części lekcji. 1. Część wstępna. 2. Część realizacji. 3. Część podsumowująca. Karty pracy. 1.

Bardziej szczegółowo

PODSTAWY BIOINFORMATYKI ORGANIZACJA ZAJĘĆ BIOINFORMATYKA PRZETWARZANIE I ANALIZA DANYCH

PODSTAWY BIOINFORMATYKI ORGANIZACJA ZAJĘĆ BIOINFORMATYKA PRZETWARZANIE I ANALIZA DANYCH PODSTAWY BIOINFORMATYKI ORGANIZACJA ZAJĘĆ BIOINFORMATYKA PRZETWARZANIE I ANALIZA DANYCH Magda Mielczarek Podstawy Bioinformatyki 1 Organizacja zajęć mgr Magda Mielczarek Katedra Genetyki, pokój nr 14 magda.mielczarek@up.wroc.pl

Bardziej szczegółowo

Uchwała nr 85/2017 z dnia 30 maja 2017 r. Senatu Uniwersytetu Medycznego w Łodzi

Uchwała nr 85/2017 z dnia 30 maja 2017 r. Senatu Uniwersytetu Medycznego w Łodzi Uchwała nr 85/2017 z dnia 30 maja 2017 r. Senatu Uniwersytetu Medycznego w Łodzi w sprawie potwierdzenia utworzenia na Wydziale Nauk Biomedycznych i Kształcenia Podyplomowego Uniwersytetu Medycznego w

Bardziej szczegółowo

WIEDZA. wskazuje lokalizacje przebiegu procesów komórkowych

WIEDZA. wskazuje lokalizacje przebiegu procesów komórkowych Załącznik nr 7 do zarządzenia nr 12 Rektora UJ z 15 lutego 2012 r. Opis zakładanych efektów kształcenia na studiach podyplomowych Nazwa studiów: Medycyna Molekularna w Praktyce Klinicznej Typ studiów:

Bardziej szczegółowo

WPROWADZENIE DO BAZ DANYCH

WPROWADZENIE DO BAZ DANYCH WPROWADZENIE DO BAZ DANYCH Pojęcie danych i baz danych Dane to wszystkie informacje jakie przechowujemy, aby w każdej chwili mieć do nich dostęp. Baza danych (data base) to uporządkowany zbiór danych z

Bardziej szczegółowo

Rozkład materiału z biologii dla klasy III AD. 7 godz / tyg rok szkolny 2016/17

Rozkład materiału z biologii dla klasy III AD. 7 godz / tyg rok szkolny 2016/17 Rozkład materiału z biologii dla klasy III AD zakres rozszerzony LO 7 godz / tyg rok szkolny 2016/17 Biologia na czasie 2 zakres rozszerzony nr dopuszczenia 564/2/2012 Biologia na czasie 3 zakres rozszerzony

Bardziej szczegółowo

Porównywanie i dopasowywanie sekwencji

Porównywanie i dopasowywanie sekwencji Porównywanie i dopasowywanie sekwencji Związek bioinformatyki z ewolucją Wraz ze wzrostem dostępności sekwencji DNA i białek narodziła się nowa dyscyplina nauki ewolucja molekularna Ewolucja molekularna

Bardziej szczegółowo

Wprowadzenie do biologii molekularnej.

Wprowadzenie do biologii molekularnej. Wprowadzenie do biologii molekularnej. Materiały dydaktyczne współfinansowane ze środków Unii Europejskiej w ramach Europejskiego Funduszu Społecznego. Biologia molekularna zajmuje się badaniem biologicznych

Bardziej szczegółowo

Wykorzystanie standardów serii ISO 19100 oraz OGC dla potrzeb budowy infrastruktury danych przestrzennych

Wykorzystanie standardów serii ISO 19100 oraz OGC dla potrzeb budowy infrastruktury danych przestrzennych Wykorzystanie standardów serii ISO 19100 oraz OGC dla potrzeb budowy infrastruktury danych przestrzennych dr inż. Adam Iwaniak Infrastruktura Danych Przestrzennych w Polsce i Europie Seminarium, AR Wrocław

Bardziej szczegółowo

PLAN REALIZACJI MATERIAŁU NAUCZANIA Z INFORMATYKI II. Uczeń umie: Świadomie stosować się do zasad regulaminów (P).

PLAN REALIZACJI MATERIAŁU NAUCZANIA Z INFORMATYKI II. Uczeń umie: Świadomie stosować się do zasad regulaminów (P). PLAN REALIZACJI MATERIAŁU NAUCZANIA Z INFORMATYKI II DZIAŁ I: KOMPUTER W ŻYCIU CZŁOWIEKA. 1. Lekcja organizacyjna. Zapoznanie uczniów z wymaganiami edukacyjnymi i PSP. 2. Przykłady zastosowań komputerów

Bardziej szczegółowo

Wybrane techniki badania białek -proteomika funkcjonalna

Wybrane techniki badania białek -proteomika funkcjonalna Wybrane techniki badania białek -proteomika funkcjonalna Proteomika: umożliwia badanie zestawu wszystkich (lub prawie wszystkich) białek komórkowych Zalety analizy proteomu w porównaniu z analizą trankryptomu:

Bardziej szczegółowo

wykład dla studentów II roku biotechnologii Andrzej Wierzbicki

wykład dla studentów II roku biotechnologii Andrzej Wierzbicki Genetyka ogólna wykład dla studentów II roku biotechnologii Andrzej Wierzbicki Uniwersytet Warszawski Wydział Biologii andw@ibb.waw.pl http://arete.ibb.waw.pl/private/genetyka/ Wykład 5 Droga od genu do

Bardziej szczegółowo

Analiza danych pochodzących z sekwencjonowania nowej generacji - przyrównanie do genomu referencyjnego. - część I -

Analiza danych pochodzących z sekwencjonowania nowej generacji - przyrównanie do genomu referencyjnego. - część I - pochodzących z sekwencjonowania nowej generacji - przyrównanie do genomu referencyjnego - część I - Katedra Genetyki Uniwersytet Przyrodniczy we Wrocławiu Plan wykładów --------------------------------------------------------

Bardziej szczegółowo

Każdy system GIS składa się z: - danych - sprzętu komputerowego - oprogramowania - twórców i użytkowników

Każdy system GIS składa się z: - danych - sprzętu komputerowego - oprogramowania - twórców i użytkowników System Informacji Geograficznej (GIS: ang. Geographic Information System) system informacyjny służący do wprowadzania, gromadzenia, przetwarzania oraz wizualizacji danych geograficznych. Najbardziej oczywistą

Bardziej szczegółowo

Bioinformatyka 2 (BT172) Struktura i organizacja kursu

Bioinformatyka 2 (BT172) Struktura i organizacja kursu Bioinformatyka 2 (BT172) Wykład 1 Struktura i organizacja kursu dr Krzysztof Murzyn adiunkt w Zakładzie Biofizyki WBtUJ pok. B028, tel. 664-6379 10.X.2005 PODSTAWOWE INFORMACJE 9 godz. wykładów (45 min,

Bardziej szczegółowo

Skrypt Bioinformatyka DRAFT Strona 67

Skrypt Bioinformatyka DRAFT Strona 67 Spis treści 5 Budowa kwasów nukleinowych... 68 5.1 Nukleotydy... 68 5.2 Łaocuch polinukleotydowy... 71 5.3 Nić komplementarna... 71 6 Centralny dogmat Biologii Molekularnej... 74 7 Przepływ informacji

Bardziej szczegółowo

SCENARIUSZ LEKCJI BIOLOGII Z WYKORZYSTANIEM FILMU Transkrypcja RNA

SCENARIUSZ LEKCJI BIOLOGII Z WYKORZYSTANIEM FILMU Transkrypcja RNA SCENARIUSZ LEKCJI BIOLOGII Z WYKORZYSTANIEM FILMU Transkrypcja RNA SPIS TREŚCI: I. Wprowadzenie. II. Części lekcji. 1. Część wstępna. 2. Część realizacji. 3. Część podsumowująca. III. Karty pracy. 1. Karta

Bardziej szczegółowo

PROGRAM RETROKONWERSJI ZDALNEJ

PROGRAM RETROKONWERSJI ZDALNEJ ul. Mołdawska 18, 61-614 Poznań tel. / fax. (-61) 656-44-10 adres do korespondencji: os. Stefana Batorego 13/27 60-969 POZNAÑ 60, skr. 40 PROGRAM RETROKONWERSJI ZDALNEJ dla systemów SOWA opracował zespół

Bardziej szczegółowo

Konspekt do lekcji informatyki dla klasy II gimnazjum. TEMAT(1): Baza danych w programie Microsoft Access.

Konspekt do lekcji informatyki dla klasy II gimnazjum. TEMAT(1): Baza danych w programie Microsoft Access. Konspekt do lekcji informatyki dla klasy II gimnazjum. Opracowała: Mariola Franek TEMAT(1): Baza danych w programie Microsoft Access. Cel ogólny: Zapoznanie uczniów z możliwościami programu Microsoft Access.

Bardziej szczegółowo

Mutacje jako źródło różnorodności wewnątrzgatunkowej

Mutacje jako źródło różnorodności wewnątrzgatunkowej Mutacje jako źródło różnorodności wewnątrzgatunkowej Zajęcia terenowe: Zajęcia w klasie: Poziom nauczania oraz odniesienie do podstawy programowej: Liceum IV etap edukacyjny zakres rozszerzony: Różnorodność

Bardziej szczegółowo

Dopasowywanie sekwencji (ang. sequence alignment) Metody dopasowywania sekwencji. Homologia a podobieństwo sekwencji. Rodzaje dopasowania

Dopasowywanie sekwencji (ang. sequence alignment) Metody dopasowywania sekwencji. Homologia a podobieństwo sekwencji. Rodzaje dopasowania Wprowadzenie do Informatyki Biomedycznej Wykład 2: Metody dopasowywania sekwencji Wydział Informatyki PB Dopasowywanie sekwencji (ang. sequence alignment) Dopasowywanie (przyrównywanie) sekwencji polega

Bardziej szczegółowo

I. Genetyka. Dział programu Lp. Temat konieczny podstawowy rozszerzający

I. Genetyka. Dział programu Lp. Temat konieczny podstawowy rozszerzający I. Genetyka 1. Czym jest genetyka? wymienia cechy gatunkowe i indywidualne podanych organizmów wyjaśnia, że jego podobieństwo do rodziców jest wynikiem dziedziczenia cech definiuje pojęcia genetyka oraz

Bardziej szczegółowo

Klonowanie molekularne Kurs doskonalący. Zakład Geriatrii i Gerontologii CMKP

Klonowanie molekularne Kurs doskonalący. Zakład Geriatrii i Gerontologii CMKP Klonowanie molekularne Kurs doskonalący Zakład Geriatrii i Gerontologii CMKP Etapy klonowania molekularnego 1. Wybór wektora i organizmu gospodarza Po co klonuję (do namnożenia DNA [czy ma być metylowane

Bardziej szczegółowo

Sesja sponsorowana przez Polską Sieć Biologii Molekularnej SESJA 1 ORGANIZACJA MATERIAŁU GENETYCZNEGO WYKŁADY

Sesja sponsorowana przez Polską Sieć Biologii Molekularnej SESJA 1 ORGANIZACJA MATERIAŁU GENETYCZNEGO WYKŁADY Sesja sponsorowana przez Polską Sieć Biologii Molekularnej SESJA 1 ORGANIZACJA MATERIAŁU GENETYCZNEGO WYKŁADY 12 SESJA 1 WYKŁADY W01-01 ORGANIZACJA GENOMU BAKTERIOFAGA P1, IMPLIKACJE DLA PROCESU PROPAGACJI

Bardziej szczegółowo

WPROWADZENIE DO GENETYKI MOLEKULARNEJ

WPROWADZENIE DO GENETYKI MOLEKULARNEJ WPROWADZENIE DO GENETYKI MOLEKULARNEJ Replikacja organizacja widełek replikacyjnych Transkrypcja i biosynteza białek Operon regulacja ekspresji genów Prowadzący wykład: prof. dr hab. Jarosław Burczyk REPLIKACJA

Bardziej szczegółowo

Samouczek: Konstruujemy drzewo

Samouczek: Konstruujemy drzewo ROZDZIAŁ 2 Samouczek: Konstruujemy drzewo Po co nam drzewa filogenetyczne? Drzewa filogenetyczne często pojawiają się dzisiaj w pracach z dziedziny biologii molekularnej, które nie mają związku z filogenetyką

Bardziej szczegółowo

Jaki koń jest nie każdy widzi - genomika populacji polskich ras koni

Jaki koń jest nie każdy widzi - genomika populacji polskich ras koni Jaki koń jest nie każdy widzi - genomika populacji polskich ras koni Gurgul A., Jasielczuk I., Semik-Gurgul E., Pawlina-Tyszko K., Szmatoła T., Bugno-Poniewierska M. Instytut Zootechniki PIB Zakład Biologii

Bardziej szczegółowo

OBSERWATRIUM POLITYKI SPOŁECZNEJ

OBSERWATRIUM POLITYKI SPOŁECZNEJ Diagnozowanie lokalnych potrzeb i problemów bazy danych MAŁOPOLSKIEGO OBSERWATRIUM POLITYKI SPOŁECZNEJ Regionalna Platforma Współpracy Kraków, 28.06.2012 r. 3 REGIONALNE BAZY DANYCH Internetowa Biblioteka

Bardziej szczegółowo

ANALIZA DANYCH POCHODZĄCYCH Z SEKWENCJONOWANIA NASTĘPNEJ GENERACJI

ANALIZA DANYCH POCHODZĄCYCH Z SEKWENCJONOWANIA NASTĘPNEJ GENERACJI ANALIZA DANYCH POCHODZĄCYCH Z SEKWENCJONOWANIA NASTĘPNEJ GENERACJI JOANNA SZYDA MAGDALENA FRĄSZCZAK MAGDA MIELCZAREK WSTĘP 1. Katedra Genetyki 2. Pracownia biostatystyki 3. Projekty NGS 4. Charakterystyka

Bardziej szczegółowo

Entrez, wyszukiwarka dla nauk przyrodniczych: globalna kwerenda

Entrez, wyszukiwarka dla nauk przyrodniczych: globalna kwerenda Pomoc Entrez Entrez skupia literaturę naukową, bazy danych DNA i sekwencji białkowych, informacje o strukturach 3D oraz domenach białek, zbiory danych o badaniach na temat populacji, informacje o ekspresji,

Bardziej szczegółowo

Konspekt do zajęć z przedmiotu Genetyka dla kierunku Położnictwo dr Anna Skorczyk-Werner Katedra i Zakład Genetyki Medycznej

Konspekt do zajęć z przedmiotu Genetyka dla kierunku Położnictwo dr Anna Skorczyk-Werner Katedra i Zakład Genetyki Medycznej Seminarium 1 część 1 Konspekt do zajęć z przedmiotu Genetyka dla kierunku Położnictwo dr Anna Skorczyk-Werner Katedra i Zakład Genetyki Medycznej Genom człowieka Genomem nazywamy całkowitą ilość DNA jaka

Bardziej szczegółowo

Z nowym bitem. Informatyka dla gimnazjum. Część II

Z nowym bitem. Informatyka dla gimnazjum. Część II Z nowym bitem. Informatyka dla gimnazjum. Część II Wymagania na poszczególne oceny szkolne Grażyna Koba Spis treści 1. Algorytmika i programowanie... 2 2. Obliczenia w arkuszu kalkulacyjnym... 4 3. Bazy

Bardziej szczegółowo

PLAN ZARZĄDZANIA WYMAGANIAMI PROJEKT <NAZWA PROJEKTU> WERSJA <NUMER WERSJI DOKUMENTU>

PLAN ZARZĄDZANIA WYMAGANIAMI PROJEKT <NAZWA PROJEKTU> WERSJA <NUMER WERSJI DOKUMENTU> Załącznik nr 4.4 do Umowy nr 35-ILGW-253-.../20.. z dnia... MINISTERSTWO FINANSÓW DEPARTAMENT INFORMATYKI PLAN ZARZĄDZANIA WYMAGANIAMI PROJEKT WERSJA numer wersji

Bardziej szczegółowo

Wymagania edukacyjne z przedmiotu Biologia. Podręcznik Biologia na czasie wyd. Nowa Era, zakres podstawowy Rok szkolny 2013/2014

Wymagania edukacyjne z przedmiotu Biologia. Podręcznik Biologia na czasie wyd. Nowa Era, zakres podstawowy Rok szkolny 2013/2014 Wymagania edukacyjne z przedmiotu Biologia. Podręcznik Biologia na czasie wyd. Nowa Era, zakres podstawowy Rok szkolny 2013/2014 Dział programu I. Od genu do cechy Lp. Temat Poziom wymagań dopuszczający

Bardziej szczegółowo

Genetyka w nowej podstawie programowej

Genetyka w nowej podstawie programowej Genetyka w nowej podstawie programowej Dział Genetyka - III etap edukacyjny Rzetelna realizacja tego działu w gimnazjum jest kluczowa ze względu na to, że biotechnologia i inżynieria genetyczna jest omawiana

Bardziej szczegółowo

Krzysztof Kadowski. PL-E3579, PL-EA0312,

Krzysztof Kadowski. PL-E3579, PL-EA0312, Krzysztof Kadowski PL-E3579, PL-EA0312, kadowski@jkk.edu.pl Bazą danych nazywamy zbiór informacji w postaci tabel oraz narzędzi stosowanych do gromadzenia, przekształcania oraz wyszukiwania danych. Baza

Bardziej szczegółowo

Krok 3: Przeszukiwanie baz projektów europejskich

Krok 3: Przeszukiwanie baz projektów europejskich Zbadaj innowacyjność swojego pomysłu badawczego Krok 3: Przeszukiwanie baz projektów europejskich Angelika Łysiak Regionalne Centrum Innowacji i Transferu Technologii Zachodniopomorski Uniwersytet Technologiczny

Bardziej szczegółowo

Co to jest transkryptom? A. Świercz ANALIZA DANYCH WYSOKOPRZEPUSTOWYCH 2

Co to jest transkryptom? A. Świercz ANALIZA DANYCH WYSOKOPRZEPUSTOWYCH 2 ALEKSANDRA ŚWIERCZ Co to jest transkryptom? A. Świercz ANALIZA DANYCH WYSOKOPRZEPUSTOWYCH 2 Ekspresja genów http://genome.wellcome.ac.uk/doc_wtd020757.html A. Świercz ANALIZA DANYCH WYSOKOPRZEPUSTOWYCH

Bardziej szczegółowo

Opis kierunkowych efektów kształcenia w obszarze nauk przyrodniczych na I stopniu kierunku BIOLOGIA

Opis kierunkowych efektów kształcenia w obszarze nauk przyrodniczych na I stopniu kierunku BIOLOGIA Opis kierunkowych efektów kształcenia w obszarze nauk przyrodniczych na I stopniu kierunku BIOLOGIA Umiejscowienie kierunku w obszarze kształcenia Kierunek studiów BIOLOGIA o profilu ogólnoakademickim

Bardziej szczegółowo

Możliwości i potencjalne zastosowania Zintegrowanego Systemu Analitycznego do innowacyjnych i kompleksowych badań molekularnych

Możliwości i potencjalne zastosowania Zintegrowanego Systemu Analitycznego do innowacyjnych i kompleksowych badań molekularnych Możliwości i potencjalne zastosowania Zintegrowanego Systemu Analitycznego do innowacyjnych i kompleksowych badań molekularnych Dzień Otwarty Klastra LifeScience 31 maj 2017, Kraków dr Agata Piestrzyńska-Kajtoch,

Bardziej szczegółowo

Techniki molekularne w biologii SYLABUS A. Informacje ogólne

Techniki molekularne w biologii SYLABUS A. Informacje ogólne Techniki molekularne w biologii SYLABUS A. Informacje ogólne Elementy sylabusu Nazwa jednostki prowadzącej kierunek Nazwa kierunku studiów Poziom kształcenia Profil studiów Forma studiów Kod przedmiotu

Bardziej szczegółowo

Omówienie normy PN-ISO 690-2 Informacja i dokumentacja. Przypisy bibliograficzne. Dokumenty elektroniczne i ich części

Omówienie normy PN-ISO 690-2 Informacja i dokumentacja. Przypisy bibliograficzne. Dokumenty elektroniczne i ich części Oprac. Agata Arkabus Publiczna Biblioteka Pedagogiczna RODN,,WOM w Częstochowie Omówienie normy PN-ISO 690-2 Informacja i dokumentacja. Przypisy bibliograficzne. Dokumenty elektroniczne i ich części 1.

Bardziej szczegółowo

Wykład 2. Relacyjny model danych

Wykład 2. Relacyjny model danych Wykład 2 Relacyjny model danych Wymagania stawiane modelowi danych Unikanie nadmiarowości danych (redundancji) jedna informacja powinna być wpisana do bazy danych tylko jeden raz Problem powtarzających

Bardziej szczegółowo

Database Connectivity

Database Connectivity Oprogramowanie Systemów Pomiarowych 15.01.2009 Database Connectivity Dr inŝ. Sebastian Budzan Zakład Pomiarów i Systemów Sterowania Tematyka Podstawy baz danych, Komunikacja, pojęcia: API, ODBC, DSN, Połączenie

Bardziej szczegółowo

Studia podyplomowe: Nauczanie biologii w gimnazjach i szkołach ponadgimnazjalnych

Studia podyplomowe: Nauczanie biologii w gimnazjach i szkołach ponadgimnazjalnych Studia podyplomowe: Nauczanie biologii w gimnazjach i szkołach ponadgimnazjalnych Głównym celem studiów podyplomowych Nauczanie biologii w gimnazjach i szkołach ponadgimnazjalnych jest przekazanie słuchaczom

Bardziej szczegółowo