7. KOLUMNOWA CHROMATOGRAFIA CIECZOWA W ROZDZIELANIU PEPTYDÓW I BIA EK

Wielkość: px
Rozpocząć pokaz od strony:

Download "7. KOLUMNOWA CHROMATOGRAFIA CIECZOWA W ROZDZIELANIU PEPTYDÓW I BIA EK"

Transkrypt

1 kolumnowa chromatografia cieczowa.qxp :43 Page KOLUMNOWA CHROMATOGRAFIA CIECZOWA W ROZDZIELANIU PEPTYDÓW I BIA EK Daniel Jastrzêbski, Marian Kamiñski 7.1. WPROWADZENIE Peptydy i bia³ka maj¹ ogromne znaczenie w organizmach ywych jako enzymy, hormony, przeciwcia³a i inne sk³adniki komórek i p³ynów fizjologicznych. Niektóre peptydy wykazuj¹ aktywnoœæ antybiotyczn¹. Koniecznoœæ uzupe³niania braków okreœlonych peptydów i bia³ek w organizmie lub stosowania peptydowych antybiotyków, albo innych leków peptydowych, poci¹ga za sob¹ potrzebê otrzymywania tych substancji w formie biologicznie aktywnej. Najczêœciej wymagana jest równoczeœnie bardzo wysoka czystoœæ izolowanych substancji. Peptydy i bia³ka mo na otrzymaæ w sposób tradycyjny, wyodrêbniaj¹c je z tkanek zwierzêcych (w tym ludzkich), a niekiedy tak e z roœlin. Ostatnio, roœnie znaczenie chemicznych, a szczególnie biotechnologicznych metod syntezy peptydów i bia³ek. Dobór odpowiedniej techniki rozdzielania potrzebnych peptydów i bia³ek od zanieczyszczeñ, a nastêpnie optymalnych warunków wyodrêbniania, zapewniaj¹cych otrzymanie produktu o najwy szej aktywnoœci biologiczne stanowi z regu³y trudny problem separacyjny. atwiejsza czêsto do opracowania jest metodyka oznaczania zawartoœci wyodrêbnianych substancji w pó³produktach oraz w finalnym produkcie. Trzeba jednak mieæ œwiadomoœæ, e jest to tak e problem, wymagaj¹cy czêsto znacznego nak³adu pracy eksperymentalnej. Wœród ró nych sposobów rozdzielania peptydów i bia³ek dominuj¹ce znaczenie identyfikacyjne i analityczne posiadaj¹ metody elektroforetyczne. Wa ne i ci¹gle rosn¹ce znaczenie posiada te wykorzystanie wysokosprawnej chromatografii cieczowej (HPLC). Chromatografia cieczowa bywa u ywana w zastosowaniach analitycznych do identyfikacji i oznaczania zawartoœci peptydów o niskich masach cz¹steczkowych, które trudno rozdzieliæ w warunkach elektroforezy elowej. Ogromn¹ karierê robi obecnie stosowanie HPLC - MS w proteomice do identyfikacji bia³ek na podstawie sk³adu peptydów po dzia³aniu na bia³ko trypsyn¹ w œciœle kontrolowanych warunkach (tripsine digestion peptide mapping). Analityka przebiega w warunkach elucji gradientowej z zastosowaniem kolumn HPLC o szczególnie wysokiej sprawnoœci i odbywa siê z regu³y trybie prze³¹czania kolumn. Rys 7.1. przedstawia przyk³ad chromatogramu rozdzielania peptydów powsta³ych z kazeiny pod dzia³aniem trypsyny. Jest to swego rodzaju odcisk palca bia³ka poddanego dzia³aniu trypsyny. W powi¹zaniu z odpowiednimi bazami danych biolodzy i biotechnolodzy uzyskali ostatnio szczególnie efektywne narzêdzie badañ bazuj¹ce na HPLC. W ostatnim czasie mo na znaleÿæ wiele publikacji, dotycz¹cych zasad stosowania HPLC w zakresie proteomiki. 107

2 kolumnowa chromatografia cieczowa.qxp :43 Page 108 Rys Przyk³ad chromatogramu kazeiny po dzia³aniu trypsyn¹. Kolumna Jupiter Proteo 90A Jupiter - "HPLC columns for the proteomic era". Chromatografia cieczowa w skali preparatywnej i procesowej, ma w zastosowaniu do bia³ek i peptydów wa ne znaczenie preparatywne oraz produkcyjne. Coraz czêœciej mo na dzisiaj spotkaæ w halach przemys³owych zak³adów farmaceutycznych instalacje wykorzystuj¹ce kolumny chromatograficzne i chromatografiê cieczow¹ w skali procesowej do rozdzielania peptydów i bia³ek oraz nie tylko tych substancji. Do rozdzielania peptydów i bia³ek z zastosowaniem chromatografii cieczowej wykorzystywane s¹ praktycznie wszystkie znane uk³ady chromatograficzne. Stosowana jest chromatografia elowa (GPC - gel permeation chromatography, albo SEC - size exclusion chromatography), chromatografia jonowymienna (IEC - ion exchange chromatography, w tym, chromatografia wykluczania jonowego - ion exclusion chromatography). Wykorzystuje siê chromatografiê adsorpcyjn¹, najczêœciej w uk³adach faz odwróconych w klasycznej postaci (RP- HPLC - reverse phase high performance chromatography) oraz chromatografiê oddzia³ywañ hydrofobowych (HIC - hydrophobic interaction chromatography), a nawet chromatografiê adsorpcyjn¹ w uk³adach faz normalnych (NP-HPLC - normal phase high performance chromatography), szczególnie, z chemicznie zwi¹zan¹ faz¹ stacjonarn¹. Dodatkowo, bardzo szerokie zastosowanie znajduj¹ metody chromatografii powinowactwa (Affinity Chromatography - AC), jako odrêbna grupa metod separacyjnych o szczególnie wysokiej selektywnoœci i specyficznoœci. W literaturze opisano wiele procedur rozdzielania, które s¹ aktualne dla konkretnego problemu rozdzielczego, tzn. do rozdzielania konkretnych peptydów, bia³ek i ich zanieczyszczeñ. Nie opracowano, jednak, dotychczas w sposób zadowalaj¹cy, takich ogólnych regu³, które umo liwia³yby dobór odpowiednich warunków rozdzielania w zale noœci od pierwszo - i wy ej rzêdowej struktury rozdzielanych peptydów i bia³ek. Analizuj¹c literaturê prezentuj¹c¹ warunki rozdzielania peptydów i bia³ek mo na, jednak, zauwa yæ pewne dominuj¹ce kierunki postêpowania i na tej podstawie przedstawiæ uogólnione zasady doboru warunków rozdzielania tych substancji z zastosowaniem chromatografii cieczowej. Dalej omówiono stosowane najczêœciej sposoby wp³ywania na selektywnoœæ i sprawnoœæ uk³adu chromatograficznego w przypadku najwa niejszych metod rozdzielania peptydów i bia³ek z wykorzystaniem elucyjnej chromatografii cieczowej 108

3 kolumnowa chromatografia cieczowa.qxp :43 Page EFEKTY I ZJAWISKA WP YWAJ CE NA SELEKTYWNOŒÆ ROZDZIELANIA PEPTYDÓW I BIA EK W WARUNKACH CHROMATOGRAFII CIECZOWEJ ORAZ PRZYK ADY CZÊSTO STOSOWANYCH WARUNKÓW ROZDZIELANIA Peptydy i bia³ka s¹, jak wiadomo, jednoczeœnie kwasami i zasadami. W strukturze cz¹steczki z³o onej z n aminokwasów wystêpuje n-1 wi¹zañ peptydowych, a tak e mo liwoœæ istnienia tzw. mostków disiarczkowych oraz wewnêtrznych wi¹zañ wodorowych, determinuj¹cych drugo- i trzecio- rzêdow¹ strukturê cz¹steczki. Obecnoœæ aminokwasów zawieraj¹cych hydrofobowe fragmenty wp³ywa na wzrost ogólnej hydrofobowoœci cz¹steczki peptydu / bia³ka. W zale noœci od ph rozpuszczalnika mo e mieæ miejsce dysocjacja protonu od zewnêtrznej grupy karboksylowej (ph powy ej punktu izoelektyrycznego) lub protonowanie n-terminalnej grupy aminowej (ph poni ej punktu izoelektrycznego), albo szczególnie silne obni enie rozpuszczalnoœci peptydu dla ph odpowiadaj¹cego punktowi izoelektrycznemu. Dysocjacja elektrolityczna peptydów i bia³ek oraz znaczne spolaryzowanie wi¹zañ peptydowych powoduje, e substancje te - w zale noœci od ph oraz sk³adu rozpuszczalnika, mog¹ tworzyæ pary jonowe oraz byæ solwatowane przez substancje bêd¹ce donorem elektronów, jaki i przez akceptory elektronów. Gdy cz¹steczki substancji tworz¹cych z peptydem parê jonow¹, albo solwatuj¹cych peptyd posiadaj¹ czêœæ nie polarn¹, to w wyniku solwatacji mo e nastêpowaæ zasadniczy wzrost hydrofobowoœci agregatu. Znaczny wzrost hydrofobowoœci, zwi¹zany z tzw. zjawiskiem wysalania, ma te miejsce w przypadku umieszczenia bia³ka w bardzo stê onym roztworze soli. Wszystkie te zjawiska maj¹ wp³yw na zachowanie siê cz¹steczek peptydów i bia³ek w roztworach oraz na ich oddzia³ywania z faz¹ stacjonarn¹ w ró nych uk³adach chromatograficznych. Dodatkowo komplikowaæ mo e sytuacjê tendencja niektórych peptydów i bia³ek do kondensacji i tworzenia w okreœlonych warunkach wysokomolekularnych agregatów. Na retencjê i na stopieñ rozdzielenia peptydów i bia³ek ma, wiêc, wp³yw szereg parametrów uk³adu chromatograficznego, takich, jak: typ powierzchni sorpcyjnej wype³nienia kolumny i uboczne oddzia³ywania na powierzchni sorbentu, powierzchnia w³aœciwa fazy stacjonarnej, wielkoœæ i porowatoœæ ziaren wype³nienia kolumny, sk³ad, ph, temperatura i prêdkoœæ przep³ywu eluentu, oddzia³ywania dodatkowych sk³adników eluentu, w tym stê enie soli w eluencie, przebieg programu elucji i inne parametry, w tym, nawet ciœnienie podczas rozdzielania. W tabeli 7.1 zestawiono reprezentatywne przyk³ady warunków stosowania chromatografii cieczowej do rozdzielania peptydów / bia³ek w ró nych uk³adach. Dane te obejmuj¹ bardzo czêsto wykorzystywane warunki rozdzielania i mog¹ byæ przewodnikiem, przydatnym dla wstêpnego doboru warunków przy rozwi¹zywaniu problemów rozdzielczych, dotycz¹cych peptydów i bia³ek. Na podstawie danych zawartych w tabeli 1 widaæ, e prawie wszystkie znane uk³ady chromatograficzne s¹ wykorzystywane do rozdzielania peptydów i bia³ek. Jednak, najczêœciej stosowane s¹ uk³ady faz odwróconych oraz chromatografia jonowymienna, a wstêpna separacja jest wykonywana z wykorzystaniem chromatografii elowej, szczególnie z wykorzystaniem twardych sorbentów typu DIOL, ostatnio g³ównie takich, których struktura porowata bazuje ma matrycy z porowatego di-tlenku cyrkonu, albo di-tlenku tytanu. Dodatkowo, nale y zwróciæ uwagê, e do rozdzielenia i wyodrêbniania bia³ek stosowana jest te czêsto chromatografia oddzia³ywañ hydrofobowych (HIC) oraz szeroko jest wykorzystywana chromatografia powinowactwa. 109

4 kolumnowa chromatografia cieczowa.qxp :43 Page 110 Lp. Uk³ad chromatograficzny Warunki rozdzielania Substancje rozdzielane Uwagi 1 Uk³ad faz odwróconych (RP); Kolumna C A 250x4,6 mm (1,6 µm), T=20 C, v=0,6 ml/min, Eluenty: A - 0,1% TFA w H 2 O, B - 0,1% TFA w AcCN, Program elucji: 0-48 min % B, Detekcja UV nm; Kolumna C-4 300A (15µm), T=36 C, v=2 ml/min, Eluenty: A - bufor fosforanowy ph 7 + odpowiednia sól, B - 30% ipr w A, Program elucji: 0-40 min % B, Detekcja UV 280 nm; Kolumny C-8 150x4,6 mm (5 m m) + C x4,6 mm (5µm), T=21 C, v=1 ml/min, Eluenty: A - 9% MeOH + 70 mm AcNa, ph 5,75, B - 90% MeOH, 8,2% H 2 O, 1,8% ipr, Program elucji: 0-15 min 10-40% B, min 40-80% B, Detekcja FLD, wzb. 330 nm, em. 450 nm; Kolumna C A 150x4,6 mm (5µm), T=40 C, v=1,0 ml/min, Eluenty: A - 0,1% TFA w H 2 O, B - 0,085% TFA w AcCN, Program elucji: start od 5% B, prêdkoœæ przyrostu stê enia od 1% do 3%/min, Detekcja UV 280 nm; interferon γ IFNγ i jego analog AII bovine pancreatic trypsin inhibitor BPTI w grupie modelowych peptydów F-β-Ala i β-ala Warunki oddzia³ywañ hydrofobowych (HIC) - dodatek ró nych soli do eluentu A (NaCl, NaAc, (NH 4 ) 2 SO 4 ) RP MPLC z wykorzystaniem dwóch ró nych kolumn Tabela 7.1. Przyk³ady praktycznego zastosowania HPLC do rozdzielania peptydów i bia³ek wraz z warunkami cd na str. 111 chromatograficznymi. 110

5 kolumnowa chromatografia cieczowa.qxp :43 Page 111 cd ze str. 110 cd na str Chromatografia jonowymienna Kolumna C-4 300A 150x2,1 mm (5µm), T=400 C, v=0,25 ml/min, Eluenty: A - 10% AcCN + 0,1% TFA w H 2 O, B - 10% H 2 O + 0,1% TFA w AcCN Program elucji: 0-7 min - 26,5-28,6% B, 7-17 min - 28,6-30,6% B, min - 30,6-36,1% B, min - 36,1-43,3% B, Detekcja UV 214 nm; - Kolumny EMD SO 3, EMD COO -, Spherodex, Sepharose, 60x10 mm, T=50 C, v=2 ml/min, Eluent: 0,3M NaCl w 10 mm Na3PO4, ph 7, Detekcja UV 280 nm; Oznaczenie jakoœciowe i iloœciowe bia³ek w mleku lysozyme, α-chymotropsinogen A, cytochrome C, Chromatografia kationowymienna - porównanie selektywnoœci ró nych kationitów wobec bia³ek Kolumna DEAE 50x7,5 mm, v=1 ml/min, Eluenty: A - 0,05 M Tris HCl w H 2 O, ph 8, B - 0,05 M Tris HCl + 0,5 M NaCl w H 2 O, ph 8, Program elucji: 0-60 min % B, Detekcja UV 260 nm; 3 Chromatografia elowa Kolumna: Superose 6, 300x10 mm, temperatura pokojowa, v=0,5 ml/min, Eluent: 200 mm NaCl + 15 mm Tris HCl w H 2 O, ph 7.4, Detekcja UV 280 nm; peptydowe kwasy nukleinowe - PNAs Thyroglobin, immunoglobulin G, ovalbumin, myoglobulin Chromatografia anionowymienna Bia³ka o wysokich masach cz¹steczkowych 111

6 kolumnowa chromatografia cieczowa.qxp :43 Page 112 cd ze str. 111 Kolumna Superdex 200, 61,5x7,5 cm, Temperatura pokojowa, v=44 ml/min, Eluent: 40 mm Na 2 HPO 4 / NaH 2 PO 4 + 0,2M NaCl w H 2 O; Rozdzielanie polimerów immunoglobilin IVIG od monomerów Ci¹g³a chromatografia 4 Uk³ady faz normalnych Kolumna TSK gel Amide x4,6 mm, T=40 C, v=1 ml/min, Eluenty: A - AcCN-H2O 97:3 + 0,1% TFA, B - AcCN-H2O 55:45 + 0,1% TFA, Program elucji: 0-70 min % B, Detekcja UV 215 nm; FY, FGGF, FLEEI, DYMGWMDP-NH 2, NFTYGGF, AGSE, WAGGDASGE, YGGFMTSQKSQTPLVT, ASTTTNYT Badanie wp³ywu dodatków na retencjê (0,1% TFA, 0,1% TFA+0,1% TEA, 0,2% TFA+0,2% TEA) 112

7 kolumnowa chromatografia cieczowa.qxp :43 Page ROZDZIELANIE PEPTYDÓW I BIA EK W UK ADACH FAZ ODWRÓCONYCH Rozdzielanie peptydów i bia³ek w uk³adach faz odwróconych odbywa siê na powierzchni fazy stacjonarnej o okreœlonym stopniu hydrofobowoœci, z zastosowaniem sorbentów typu C18, C8, C4 (C5, C6), C2, fenyl, alkilofenyl, alkilonitryl i inne. Rozdzielane cz¹steczki peptydów i bia³ek s¹, jak wiadomo, z³o one z ró nych aminokwasów (hydrofobowych lub hydrofilowych), u³o onych w zró nicowanej kombinacji. Retencja zale y od wynikowej hydrofobowoœci rozdzielanych cz¹steczek, albo ich solwatów, tzn. zarówno od struktury i rozk³adu hydrofobowoœci w cz¹steczkach, jak i od hydrofobowoœci solwatów istniej¹cych w równowadze ze sk³adnikami eluentu. Podczas rozdzielania du ych cz¹steczek polipeptydów i bia³ek w uk³adach faz odwróconych doœæ czêsto obserwowane s¹ niekorzystne przypadki zmian konformacyjnych ³añcucha aminokwasowego i w konsekwencji denaturacja produktu. Nie polarna faza stacjonarna, organiczna faza ruchoma i kwaœne, albo alkaliczne dodatki do fazy ruchomej (kwas trifluorooctowy TFA lub inny, albo amina) - to czynniki maj¹ce potencjalne dzia³anie denaturuj¹ce, a nawet hydrolityczne. Denaturacja objawia siê najczêœciej zmian¹, retencji substancji, a hydroliza - zwiêkszeniem iloœci pików. Aby unikn¹æ hydrolizy trzeba kontrolowaæ ph i temperaturê rozdzielania. Denaturacji mo na czasem unikn¹æ przez dodatek do eluentu soli stabilizuj¹cych strukturê bia³ka (np. NaCl, AcNa, (NH 4 ) 2 SO 4 ). Trzeba siê, jednak, liczyæ z tym, e taki dodatek czêsto modyfikuje retencjê substancji. Najczêœciej do rozdzielania peptydów i bia³ek w uk³adach faz odwróconych s¹ stosowane sorbenty siloksanowe modyfikowane grupami alkilowymi, fenylowymi i difenylowymi. Wœród grup alkilowych najczêœciej wykorzystuje siê grupê butylow¹ (C4), kolejno pentylow¹ (C5) i oktylow¹ (C8). Wiele jest te zastosowañ oktadecylowych (C18) faz stacjonarnych. Rys. 7.2 przedstawia przyk³ad rozdzielania 9 bia³ek w kolumnie wype³nionej sorbentem typu C5, a chromatogram na rys. 7.3 to przyk³ad rozdzielania 8 peptydów i bia³ek w kolumnie C8. Rys Rezultaty rozdzielania mieszaniny peptydów w kolumnie typu C5. Kolumna Discovery BIO Wide Pore C5, 150x4,6 mm (5µm). Eluenty: A-H 2 O:AcCN:PFPA 81:19:0,1; B- H 2 O:AcCN:PFPA 62:38:0,1. Program elucji: 0-19 min 0-100% B, v=1,0 ml/min, T=30 C. Detekcja UV 215 nm. 1-Arg8-Vassopressina, 2-Bradykinina fragment 1-5, 3-Oxytocyna, 4-Met-Enkephalina, 5-Luteinizing Hormone, 6-Leu-Enkephalina, 7-Bradykinina, 8-Bombesina, 9-Substancja P. 113

8 kolumnowa chromatografia cieczowa.qxp :43 Page 114 Rys Przyk³ad rozdzielania peptydów i bia³ek uk³adzie faz odwróconych w kolumnie typu C8. Kolumna YMC8 Octyl S-5 120A, 250x4,6 mm (5µm); Eluenty: A-0,1% TFA, B-AcCN; Program elucji: 0-30 min 20-50% B, v=1,0 ml/min; Detekcja UV 200 nm; Piki: 1-Bradykinina, 2-Met- Enkephalina, 3-Angiotensyna I, 4-Leu-Enkephalina, 5-Substancja P, 6-Insulina, 7-Lysozym, 8-Mioglobina. G³ównym ograniczeniem stosowania kolumn z chemicznie modyfikowanym wype³nieniem siloksanowym jest ograniczone ph fazy ruchomej, które jest bezpieczne dla wi¹zañ grup funkcyjnych z elem krzemionkowym i nie powoduje ich hydrolizy (typowo , a skrajnie 1,5-10, w przypadku specjalnie opracowanych faz stacjonarnych). Okazjonalnie stosowane s¹ wype³nienia polimerowe oparte o kopolimer styrenu-diwinylobenzenu, albo poli-metakrylan alkilu. Do powierzchni sorpcyjnej najczêœciej dodatkowo zwi¹zane s¹ cz¹steczki oktadekanu (C18). Ostatnio, mimo wysokiej ceny, roœnie znaczenie polimerowych sorbentów. Powodem jest ich trwa³oœæ w szerokim zakresie ph od 0,8-13,5. Brak wolnych grup siloksanowych poprawia symetriê pików i w konsekwencji sprawnoœæ rozdzielania. Wad¹ kolumn wype³nionych polimerowymi sorbentami s¹ niskie prêdkoœci przep³ywu, jakie powinno siê stosowaæ podczas rozdzielania substancji o wysokich masach cz¹steczkowych. Zbyt du e prêdkoœci przep³ywu prowadz¹ do otrzymywania nadmiernie poszerzonych pików, szczególnie pików substancji nisko polarnych. Jest to wynikiem niekorzystnej kinetyki procesów sorpcji / desorpcji spowodowanej tendencj¹ do rozpuszczania siê cz¹steczek rozdzielanych substancji w powierzchniowej warstwie niepolarnego sorbentu. Sporadycznie stosowane s¹ inne wype³nienia, np. sorbenty siloksanowe modyfikowane równoczeœnie grupami C8 i hydrofilowymi grupami -COOH, pochodz¹cymi z nienasyconych 114

9 kolumnowa chromatografia cieczowa.qxp :43 Page 115 kwasów karboksylowych, albo specyficznie modyfikowane sorbenty siloksanowe o podwy szonej stabilnoœci mechanicznej i chemicznej. D³ugoœæ ³añcucha alkilowego ma istotny wp³yw na selektywnoœæ rozdzielania peptydów i bia³ek. River i wspó³pracownicy stwierdzili, e krótkie kolumny wype³nione polisiloksanem modyfikowanym C4 sprawdzaj¹ siê najlepiej w rozdzielaniu du ych peptydów i bia³ek. Natomiast Hartman i wspó³pracownicy udowodnili przydatnoœæ kolumn siloksanowych modyfikowanych C8 do rozdzielania naturalnych i syntetycznych peptydów oraz niewielkich bia³ek posiadaj¹cych charakter hydrofilowy. W przypadku polipeptydów, szczególnie, jeœli zawieraj¹ w ³añcuchu pierœcienie aromatyczne, skuteczne okazuj¹ siê kolumny siloksanowe modyfikowane grupami difenylowymi. Kolumny siloksanowe modyfikowane grupami oktadecylowymi (C18), o ma³ych œrednicach porów, s¹ najskuteczniejsze do rozdzielania ma³ych, hydrofilowych peptydów i fragmentów bia³ek z³o onych z 2-10 aminokwasów. Przy czym do rozdzielania peptydów stosuje siê ostatnio coraz czêœciej krótkie kolumny mikropakowane o œrednicy mm, wype³nione nieporowatym sorbentem o kulistych ziarnach wielkoœci 1 do 2 µm, zapewniaj¹ce bardzo wysok¹ sprawnoœæ rozdzielania (do 350 tys. pó³ek teoretycznych na metr d³ugoœci wype³nienia kolumny). Fazy stacjonarne zawieraj¹ce krótkie alifatyczne ³añcuchy uniemo liwiaj¹ skuteczne rozdzielanie silnie hydrofobowych peptydów i bia³ek, a d³ugie ³añcuchy alkilowe s¹ odpowiedniejsze do rozdzielania peptydów i bia³ek o charakterze mniej hydrofobowym. Wskazane jest, aby sorbenty o modyfikowanej chemicznie powierzchni sorpcyjnej by³y zabezpieczone przed oddzia³ywaniem z faz¹ ruchom¹ resztkowych grup hydroksylowych, tzn. aby mia³y tzw. end-capping - zast¹pienie wolnych grup OH grupami OCH 3, albo poprzez silanizacjê. Polepsza to symetriê pików, a st¹d stopieñ rozdzielenia w przypadku mniejszych peptydów i umo liwia wysoki stopieñ odzysku w przypadku bia³ek. Szeroko badany by³ wp³yw rozk³adu wielkoœci ziaren i porowatoœci z³o a w kolumnie na rozdzielanie peptydów i bia³ek. Stwierdzono wp³yw takich parametrów jak rozmiar i kszta³t ziaren, œrednica i kszta³t porów oraz powierzchnia wymiany masy. W zale noœci od wielkoœci rozdzielanych peptydów i bia³ek, dobiera siê z³o e o odpowiednich œrednicach porów. I tak, dla ma³ych peptydów (do 10 aminokwasów) Krstulovic i Brown zalecaj¹ kolumny z wype³nieniem o œrednicy porów do 60A, dla œrednich peptydów (10-30 aminokwasów) i ma³ych bia³ek najskuteczniejsze s¹ kolumny o œrednicy porów 100A, 120A i 150A, natomiast dla wiêkszych peptydów (ponad 30 aminokwasów) i dla bia³ek, polecaj¹ sorbenty o porach 300A i wiêkszych. Tweeten i Tweeten stwierdzili w przypadku kolumn wype³nionych makroporowatym poli -styrenem-diwinylobenzenem, e dalszy wzrost wielkoœci porów (do 1000A) nie wp³ywa na polepszenie retencji bia³ek o du ej masie cz¹steczkowej (do 335 kd). W celu maksymalizacji sprawnoœci kolumny do zastosowañ analitycznych wykorzystuje siê sorbenty o ma³ych ziarnach 5 i 3 µm, a nawet coraz czêœciej, wspomniane wy ej, nieporowate sorbenty o ziarnach 1 µm. Wtedy stosowane kolumny mog¹ mieæ nawet tylko 10 mm d³ugoœci. Najczêœciej stosuje siê kolumny o d³ugoœciach 125, 150 i 250 mm. Im mniejsza wielkoœæ ziaren sorbentu, tym krótsza mo e byæ kolumna. Obecnie du e zainteresowanie budz¹ tzw. monolityczne kolumny o porowatym wype³nieniu zajmuj¹cych ca³¹ objêtoœæ kolumny. Charakteryzuj¹ siê one szczególnie niskimi wartoœciami tzw. impedancji rozdzielania ELUENTY, MODYFIKATORY ELUENTU I PROGRAMY ELUCJI STOSOWANE W UK ADACH FAZ ODWRÓCONYCH W uk³adach faz odwróconych g³ównym czynnikiem wp³ywaj¹cym na retencjê jest zawartoœæ organicznych sk³adników w eluencie, takich jak acetonitryl (AcCN), metanol (MeOH), etanol (EtOH), izopropanol (iproh), tetrahydrofuran (THF), czy dioxan (DX). Dodatkowo, w celu optymalizacji warunków rozdzielania nale y wp³ywaæ na retencjê substancji 115

10 kolumnowa chromatografia cieczowa.qxp :43 Page 116 o charakterze zarówno kwaœnym jak i zasadowym, do których nale ¹ peptydy i bia³ka, poprzez dodatek kwaœnego lub zasadowego modyfikatora do eluentu. Rozdzielanie peptydów i bia³ek najczêœciej przeprowadza siê w warunkach elucji gradientowej, programuj¹c zmianê stê enia organicznego sk³adnika eluentu (AcCN, MeOH) w zakresie od % v/v do % v/v, dodaj¹c do eluentu A i B modyfikatora zmieniaj¹cego ph eluentu i cofaj¹cego dysocjacjê kwasowo - zasadow¹ i w konsekwencji modyfikuj¹cego hydrofobowoœæ i polarnoœæ cz¹steczek peptydów / bia³ek. Najczêœciej wykorzystywanym organicznym sk³adnikiem eluentu jest acetonitryl. Powodem tego jest jego wysoka transparentnoœæ przy niskich d³ugoœciach fali w zakresie UV, jego niska lepkoœæ oraz wysoka lotnoœæ, która u³atwia dalsz¹ izolacjê produktu. Znacznie rzadziej wykorzystywane s¹ alkohole. Niekiedy stosuje siê izopropanol, aby zwiêkszyæ rozpuszczalnoœæ w fazie ruchomej solwatów du ych peptydów i bia³ek. U ycie izopropanolu lub jego mieszaniny z acetonitrylem (w proporcji od 1:2 do 2:1) jest uzasadnione w przypadku rozdzielania peptydów i bia³ek stosunkowo bardzo hydrofobowych. Izopropanol, jako Tabela 7.2. Modyfikatory fazy ruchomej najczêœciej stosowane w uk³adach faz odwróconych. Modyfikator Kwas trójchlorooctowy (TFA) H 3 PO 4 i jego sole (np. (NH 4 ) 3 PO 4 ) HFBA (kwas heksa fluoro butyrowy) HCOOH, CH 3 COOH, HCl 116 Dzia³anie (korzystne i niekorzystne) - Eliminuje jonizacjê ewentualnych wolnych grup siloksanowych; - Cofa dysocjacjê grupy karboksylowej na "C-koñcu" aminokwasu, co zwiêksza hydrofobowoœæ tej czêœci peptydu; - Powoduje wzrost polarnoœci cz¹steczki przez tworzenie kationu R-NH 3 + na "N-koñcu" peptydu; - Dostarcza anionów CF3COO -, które stanowi¹ przeciwjon dla "N-koñcowego" kationu amoniowego tworz¹c z nim parê jonow¹; - Powoduje solwatacjê wi¹zañ peptydowych, co ma znaczenie szczególnie przy du ych peptydach i bia³kach; - Podwy sza absorpcjê œwiat³a przez eluent przy niskich d³ugoœciach fali œwiat³a w przypadku detekcji UV - pogarsza granicê oznaczalnoœci zwi¹zku; - Najczêœciej stosowane stê enie 0,05-0,13% (v/v), stê enie poni ej 0,075% mo e prowadziæ do poszerzenia pików i obni onej retencji peptydów, a powy ej 0,1% do hydrolizy wi¹zañ fazy stacjonarnej z powierzchni¹ elu krzemionkowego zw³aszcza w podwy szonej temperaturze (!); - Obni enie retencji peptydów (w porównaniu do dodatku TFA, czy do braku H 3 PO 4 lub jego soli); - Dzia³anie podobne do TFA, jednak mniej selektywne; - Dzia³anie podobne do TFA, jednak mniej selektywnie; - Kwas solny powoduje jedynie protonowanie grupy karboksylowej "C-koñca" peptydu bez tworzenia pary jonowej na "N-koñcu" zwi¹zku; - Pewne podwy szenie retencji, ale wp³yw na retencjê mniejszy ni TFA; - Podwy sza ph i zmienia nieco hydrofobowoœæ peptydu / bia³ka; NH 4 HCO 3 ; CH 3 COONH 4 - Dzia³anie podobne do NH 4 HCO 3 Trójetyloamina (TEA) - Dodawana jednoczeœnie z H 3 PO 4 lub HCOOH w celu zmiany ph; - Blokuje wolne grupy hydroksylowe sorbentu, co mo e przyczyniæ siê do polepszenia kszta³tu pików;

11 kolumnowa chromatografia cieczowa.qxp :43 Page 117 rozpuszczalnik o wy szej sile elucyjnej w uk³adach faz odwróconych od AcCN, silniej oddzia³uje z centrami alkilo - siloksanowymi sorbentu ni np. metanol. Najczêœciej stosowan¹ szybkoœci¹ narostu objêtoœciowego udzia³u sk³adnika organicznego do rozdzielania peptydów i bia³ek jest 2-5% / min. Zbyt wolny wzrost stê enia hydrofobowego sk³adnika eluentu mo e powodowaæ zbytnie rozcieñczenie otrzymywanych frakcji eluatu. Koñcowe stê enie rozpuszczalnika organicznego w programie elucji nie powinno prowadziæ do ca³kowitego usuniêcia wody z kolumny. Utrudnia³oby to doprowadzanie fazy stacjonarnej do równowagi z pocz¹tkowym eluentem. To mo e prowadziæ do braku powtarzalnoœci retencji peptydów i bia³ek, szczególnie wczeœnie eluowanych. Najczêœciej nie przekracza siê 95% substancji organicznej w eluencie. Natê enie przep³ywu fazy ruchomej przez kolumnê o œrednicy 4-4,6 mm jest rzêdu 0,8-2,0 ml/min. Od natê enia przep³ywu zale y sprawnoœæ rozdzielania oraz ciœnienie na wlocie do kolumny. Bylina i wspó³pracownicy zauwa yli wp³yw ciœnienia panuj¹cego w kolumnie na retencjê podczas rozdzielania insuliny w warunkach izokratycznych. Wzrost ciœnienia w kolumnie o 1 bar powodowa³ wzrost czasu retencji bia³ka o 1-5 s. Ostatnio Guiochon i wspó³pracownicy potwierdzili wystêpowanie tych efektów i podali próbê ich wyjaœnienia. Najwa niejsze modyfikatory fazy ruchomej, stosowane w uk³adach faz odwróconych, zestawiono w tabeli 7.2. Modyfikatory wymienione w tabeli 7.2. zmieniaj¹ ph eluentu i hydrofobowoœæ cz¹steczek rozdzielanych substancji przez cofanie dysocjacji, tworzenie par jonowych, a tak e na drodze solwatacji. Modyfikatory kwaœne maj¹ na celu zmniejszenie stopnia kwaœnej dysocjacji peptydu, a dodatki zasadowe eliminuj¹ protonowanie terminalnych grup NH 2 i powoduj¹ dysocjacjê grupy karboksylowej. Zarówno kwaœne, jak i zasadowe modyfikatory fazy ruchomej zawieraj¹ce hydrofobowe fragmenty cz¹steczki mog¹, dodatkowo, wp³ywaæ na hydrofobowoœæ poprzez solwatacjê cz¹steczek rozdzielanych peptydów ROZDZIELANIE PEPTYDÓW I BIA EK W UK ADACH JONOWYMIENNYCH W chromatografii jonowymiennej jest zasad¹, e substancje posiadaj¹ce ³adunek elektryczny s¹ rozdzielane na kolumnie, która ma na powierzchni sorpcyjnej odwrotny ³adunek elektryczny do substancji rozdzielanych. Grupy jonowe wymieniacza jonowego s¹ kowalencyjnie wi¹zane z powierzchni¹ sorbentu i ich ³adunki elektryczne s¹ kompensowane przez jony obecne w eluencie (buforze). Po wprowadzeniu próbki do kolumny centra jonowe s³abo zwi¹zane z eluentem, ulegaj¹ wymianie na jony substancji rozdzielanych. Wykorzystuje siê okolicznoœæ, e peptydy i bia³ka mog¹ posiadaæ zarówno ³adunek dodatni, jak ujemny. Podczas stosowania buforów o charakterze kwaœnym, peptydy wystêpuj¹ w postaci kationów (zahamowanie dysocjacji grup karboksylowych i sprotonowanie grup aminowych oraz najbardziej polarnych grup NH 2 w po³¹czeniach peptydowych). W przypadku stosowania buforów zasadowych, peptydy i bia³ka wystêpuj¹ w postaci anionów (sprotonowane grupy aminowe s¹ zasadami wi¹ ¹cymi grupy hydroksylowe, a grupy karboksylowe s¹ zdysocjowane, albo tworz¹ pary jonowe ze sprotonowanymi kationami zasadowych dodatków). Netto dodatni lub ujemny elektryczny ³adunek peptydu / bia³ka umo liwia jego zwi¹zanie z odpowiednimi centrami fazy stacjonarnej. Z zastosowaniem gradientu soli, lub niekiedy dodatkowo zmiany ph buforu, powoduje siê stopniow¹ elucjê substancji zwi¹zanych z powierzchni¹ wymieniacza jonowego. Na retencjê peptydów i bia³ek wp³ywaj¹ g³ównie trzy czynniki: si³a jonowa eluentu, jego ph i powierzchnia w³aœciwa wymieniacza jonowego (gêstoœæ obsadzenia moleku³ami wymieniacza jonowego) a tak e rozk³ad wielkoœci porów adsorbentu. Zwiêkszaj¹c si³ê jonow¹ eluentu obni amy retencjê peptydów i bia³ek w przypadku obu wymieniaczy, kationów i anionów. Zwiêkszaj¹c ph buforu obni amy retencjê na kationitach, a podwy szamy na anionitach i odwrotnie - zmniejszaj¹c ph buforu podwy szamy retencje na kationitach, a obni amy na anion- 117

12 kolumnowa chromatografia cieczowa.qxp :43 Page 118 itach. Poszerzenie zakresu œrednic porów w stosunku do hydrodynamicznej œrednicy cz¹steczek rozdzielanych bia³ek przyczynia siê do podwy szenia retencji w przypadku stosowania kationitów i prawdopodobnie tak e w przypadku anionitów. Wzrost stopnia obsadzenia powierzchni jonitu grupami jonowymiennymi wp³ywa oczywiœcie na wzrost retencji w konkretnych warunkach rozdzielania. Jednak, do rozdzielania peptydów i bia³ek w warunkach chromatografii elucyjnej nie s¹ zalecane wymieniacze jonowe o bardzo wysokim stopniu nasycenia powierzchni sorpcyjnej grupami jonowymiennymi w przeciwieñstwie do chromatografii jonowymiennej wykonywanej w warunkach selektywnej sorpcji - desorpcji jonowymiennej, gdy pojemnoœæ jonowa wymieniacza jonowego powinna byæ mo liwie jak najwy sza. Do rozdzielania peptydów i bia³ek stosuje siê wiele rodzajów kolumn jonowymiennych, równorzêdnie kationowymienne i anionowymienne. Oba wymieniacze mog¹ byæ stosowane w wariantach s³abym i mocnym. W przypadku mocnych wymieniaczy jonowych wszystkie grupy funkcyjne s¹ w szerokim zakresie ph w postaci zjonizowanej i powinowactwo jonowe kolumny jest ma³o zale ne od ph eluentu, ale retencja peptydów od ph eluentu zale y silnie, poniewa w zale noœci od ph ich cz¹steczki s¹ w ró nym stopniu zjonizowane. W zale noœci od w³aœciwoœci rozdzielanego peptydu / bia³ka dobiera siê odpowiedni wymieniacz jonowy. Jako kationity stosowane s¹ kolumny ze zwi¹zanymi na powierzchni sorpcyjnej ligandami alkilo-, albo arylo- sulfonowymi: R-SO 3 - (mocne wymieniacze, np. Fractogel SO 3, Cellufine sulfate, SP), karboksylowymi R-COO -a (s³abe wymieniacze, np. Fractogel COO, Toyopearl), a tak e inne polimery o s³abo kwaœnych grupach funkcyjnych, takie, jak Sepharoza czy Spherodex. Na rys.4 przedstawiono przyk³ad rozdzielania 6 peptydów z zastosowaniem kolumny kationowymiennej. Jako anionity stosowane s¹ kolumny o ligandach w postaci grup alkilo, albo arylo amoniowych, np. mocny wymieniacz z grupami trimetyloaminoetylowymi (TMAE), œrednio mocny wymieniacz z grupami dietyloaminoetylowymi (DEAE), oraz s³aby wymieniacz z grupami dimetyloaminoetylowymi (DMAE). Ligandy jonowymienne najczêœciej osadzone s¹ na matrycy, Rys Przyk³ad rozdzielania ma³ych peptydów z u yciem chromatografii kationowymiennej [28]. Kolumna Vydac 400VHP5410, 100x4,6 mm (5µm); Eluenty: A-20mM TEAP w 50% AcCN, ph 2; B- 100mM NaClO 4 w A; Program elucji: 0-50 MIN 0-100% B, v=0,7 ml/min; Detekcja UV 220 nm. Piki: 1-Oxytocyna, 2-odpowiednik Eledoisiny, 3-Neurotensyna, 4-Angiotensyna II, 5-Bradykinina, 6- Angiotensyna I. 118

13 kolumnowa chromatografia cieczowa.qxp :43 Page 119 Rys Przyk³ad rozdzielania bia³ek z u yciem chromatografii anionowymiennej. Kolumna Vydac 300VHP575, 50x7,5 mm (5µm); Eluenty: A-10mM CHES/TEA, ph 9,53; B- 0,5M NaCl w A; Program elucji: 0-20 min 0-100% B; 1-Bovine carbonic anhydrase (pl 7,3), 2-Conalbumin (pl 6; 6,3; 6,6), 3-Ovalbumin (pl 4,7), 4-Soybean trypsin inhibitor (pl 4,5). któr¹ mo e byæ kopolimer styrenu-divinylobenzenu, ywica syntetyczna, poliwêglowodany, poliamidy, a niekiedy polimery nieorganiczne. Na rys. 7.5 zamieszczono przyk³ad wyników rozdzielania czterech bia³ek w kolumnie anionowymiennej. W przypadku wiêkszoœci komercyjnie stosowanych kolumn jonowymiennych, stosunkowo ma³e grupy jonowymienne znajduj¹ siê na powierzchni sorbentu. W takim przypadku tylko pojedyncze, ewentualnie kilka jonowych grup peptydu / bia³ka zostaje zwi¹zane ze z³o em, z powodu ograniczeñ przestrzennych. W wymieniaczach jonowych o ruchomych ligandach (tzw. tentacle ), ³añcuchy cz¹steczek wymieniacza jonowego s¹ kowalencyjnie zwi¹zane z matryc¹. S¹ to liniowe ³añcuchy polimerowe z roz³o onymi wzd³u ³añcucha grupami jonowymiennymi. Grup jonowymiennych jest znacznie wiêcej ni na powierzchni klasycznego wymieniacza i w konsekwencji znacz¹co wzrasta pojemnoœæ takich wymieniaczy wobec peptydów i bia³ek. Elastycznoœæ ruchomych ligandów wymieniacza powoduje dodatkowo, e mog¹ siê one wi¹zaæ do moleku³ bia³ek bez odkszta³cenia cz¹steczek tych ostatnich. Ma to szczególne znaczenie dla unikniêcia denaturacji w trakcie rozdzielania bia³ek o du ych masach molekularnych. Podczas rozdzielania peptydów i bia³ek z u yciem chromatografii jonowymiennej regu³¹ jest stosowanie krótkich kolumn o du ych œrednicach. Zalecane s¹ kolumny o d³ugoœciach od 5 cm (szczególnie w metodach sorpcyjno - desorpcyjnych) do 25 cm (dla warunków jonowymiennej chromatografii elucyjnej) i o œrednicach 5-26 mm lub wy szych UK ADY ADSORPCYJNE I ADSORPCYJNO - JONOWYMIENNE W NORMALNYM UK ADZIE FAZ Uk³ady chromatograficzne faz normalnych nie znajduj¹ tak szerokiego zastosowania do rozdzielania peptydów i bia³ek jak uk³ady faz odwróconych i jonowymienne. Yoshida i Okada 119

14 kolumnowa chromatografia cieczowa.qxp :43 Page 120 wykonali badania przydatnoœci do rozdzielania peptydów kilku ró nych wype³nieñ w uk³adach faz normalnych. Stwierdzili przydatnoœæ kolumn wype³nionych zwi¹zanym z elem krzemionkowym sorbentem amidowym i diolem w warunkach elucji gradientowej AcCN - H 2 O, z rosn¹cym udzia³em wody w trakcie programu elucji i z zastosowaniem kwaœnych modyfikatorów fazy ruchomej (TFA albo TFA+TEA), zwiêkszaj¹cych retencjê peptydów (patrz rys. 6 - porównanie rozdzielania 10 peptydów na kolumnie amidowej i diolowej z ró nymi dodatkami do eluentu). Odrzucili kolumny nape³nione sorbentem aminowym (NH 2 ) i nitrylowym (CN) jako nieprzydatne do rozdzielania peptydów oraz kolumny z elem krzemionkowym jako powoduj¹ce obni enie stopnia odzysku peptydów. Do rozdzielania bia³ek i peptydów zastosowano te z powodzeniem kolumny wype³nione hydroksyapatytem, wykorzystuj¹c jednoczeœnie adsorpcyjne i s³abe jonowymienne oddzia³ywania. Rys.7.6. Porównanie rozdzielania peptydów w uk³adzie faz normalnych w kolumnie amidowej (I) i diolowej (II) z ró nymi dodatkami do eluentu. Kolumna I - TSK gel Amide x4,6 mm; kolumna II - TSK gel OH x4,6 mm; Eluenty: (A) A - AcCN-H 2 O 97:3 + 0,1% TFA, B - AcCN-H 2 O 55:45 + 0,1% TFA; (B) A - AcCN-H 2 O 97:3 + 0,1% TFA+TEA, B - AcCN-H 2 O 55:45 + 0,1% TFA+TEA; (C) A-AcCN-H 2 O 97:3+0,2% TFA+TEA, B-AcCN-H 2 O 55:45+0,2% TFA+TEA; Program elucji: 70 min, liniowy gradient H 2 O od 3 do 45% (0,6% H2O/min), T=40 C, w=1,0 ml/min. Detekcja UV 215 nm; Substancje rozdzielane:1-fy, 2-FGGF, 3-FLEEI, 4-DYMGWMDP-NH2, 5- NFTYGGF, 6-AGSE, 7-WAGGDASGE, 8-YGGFMTSQKSQTPLVT, 9-ASTTTNYT, 10-M homoseryna: LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEM *) 120

15 kolumnowa chromatografia cieczowa.qxp :43 Page CHROMATOGRAFIA POWINOWACTWA Chromatografia powinowactwa (Affinity Chromatography) znajduje bardzo szerokie zastosowanie do rozdzielania bia³ek. Jest przede wszystkim wykorzystywana do specyficznych zastosowañ i do bia³ek o konkretnych w³aœciwoœciach. Jedynie tzw. chromatografia metalopowinowactwa ma doœæ ogólne zastosowanie do rozdzielania bia³ek i peptydów posiadaj¹cych atomy siarki w cz¹steczce. W innych zastosowaniach chromatografii powinowactwa metodyka postêpowania mo e byæ zwi¹zana z enzymatycznymi lub koenzymatycznymi w³aœciwoœciami wyodrêbnianego bia³ka, albo z innymi specyficznymi oddzia³ywaniami sorpcyjnymi. Mimo stosowania nazwy chromatografia powinowactwa, metody powinowactwa winny byæ raczej zaliczane do grupy metod selektywnej chemisorpcji ni do metod chromatografii elucyjnej. Wykorzystuj¹ one wysoce selektywn¹, specyficzn¹ sorpcjê niektórych moleku³ do odpowiednio przygotowanej fazy stacjonarnej, a nastêpnie odszczepienie ca³ego zwi¹zanego materia³u, po uprzednim odmyciu niezwi¹zanej z sorbenten czêœci wsadu z przestrzeni miêdzy-ziarnowej i z porów. Nale y zapewniæ dostatecznie du e pory sorbentu, aby cz¹steczki substancji wi¹zanych specyficznie do ligandu immobilizowanego na powierzchni noœnika i stanowi¹cego powierzchniê sorpcyjn¹, nie by³y wykluczane. Rys Schematyczne przedstawienie specyficznych oddzia³ywañ sorpcyjnych w warunkach chromatografii powinowactwa. Etapy postêpowania: 1) zwi¹zanie ligandu z noœnikiem, 2) sorpcja specyficzna cz¹steczek P (substancji wykazuj¹cej / wykazuj¹cych powinowactwo) 3) odszczepienie P: - czynnikiem o silniejszym powinowactwie, - poprzez zmianê ph, - poprzez wykorzystania nadmiarowego stê enia jonów 4) reaktywacja sorbentu Przyk³ady (istnieje ogromna iloœæ w literaturze specjalistycznej) oznaczanie glukohemoglobiny HbGl - metoda kliniczna, przeciwcia³a z zastosowaniem Anty IgG - ligandów proteiny roœlinne z zastosowaniem Concanavaliny A i inne CHROMATOGRAFIA ELOWA PEPTYDÓW I BIA EK Chromatografia elowa (SEC), zwana jest równie filtracj¹ elow¹ (GPC), znalaz³a bardzo szerokie zastosowanie separacyjne dla peptydów i bia³ek. Bazuje na wykorzystaniu ró nicy 121

16 kolumnowa chromatografia cieczowa.qxp :43 Page 122 wielkoœci i kszta³tu, a w konsekwencji ró nic w wartoœci efektywnego promienia hydrodynamicznego rozdzielanych substancji. Moleku³y o ró nych rozmiarach w ró nym stopniu penetruj¹ pory sorbentu. Ma³e cz¹stki s¹ w wiêkszym stopniu zatrzymywane w kolumnie, a du e s¹ szybciej eluowane (patrz rys przyk³ad rozdzielania 5 bia³ek na kolumnie diolowej). SEC ma zastosowanie do rozdzielania peptydów i bia³ek o masie molowej w zakresie 2 do 1000 kda. Technika ta mo e byæ stosowana do wyznaczania masy molowej bia³ek. Jednak nie tylko masa cz¹steczkowa, ale równie kszta³t cz¹steczki bia³ka oraz oddzia³ywania sorpcyjne trudne do ca³kowitego wyeliminowania w przypadku biopolimerów, maj¹ wp³yw na retencjê, dlatego te konieczna jest staranna kalibracja przy u yciu odpowiednich bia³ek kalibracyjnych. Du ego znaczenia nabieraj¹ ostatnio z³o a SEC wykonane w technologii ruchomych ligandów, tentacle (podobnie jak w przypadku z³ó jonowymiennych). Rozmiary porów i ich rozk³ad gwarantuj¹ rozdzielenie bia³ek zgodnie z wielkoœci¹ i kszta³tem cz¹steczek. Dynamiczne ligandy uniemo liwiaj¹ ma³ym cz¹stkom wnikniêcie wewn¹trz porów, a wiêksze moleku³y maj¹ utrudnion¹ g³êbsz¹ penetracjê. SEC jest szczególnie u yteczna jako pocz¹tkowy etap frakcjonowania do izolacji du ych iloœci zanieczyszczeñ, lub jako koñcowy etap rozdzielania oczyszczonych bia³ek, tzw. polishing step. Nale y te zwróciæ uwagê na szczególn¹ przydatnoœæ chromatografii elowej do odsalania peptydów i bia³ek. Do tego celu stosuje siê czêsto jeszcze tzw. miêkkie sita molekularne typu Sephadex z grupy G, ale coraz wiêksze znaczenie maj¹ twarde wype³nienia kolumn w tych zastosowaniach, takie jak DIOL, a tak e szk³a porowate o zdezaktywowanej powierzchni i inne. Rys.7.8. Przyk³ad rozdzielania bia³ek na kolumnie DIOL w warunkach chromatografii elowej. Kolumna Bio GPC-DIOL 250, 300x10 mm (5µm); Eluent; 10mm NaH 2 PO mm NaCl, Ph 7,2; w=0,5 ml/min, detekcja UV 280 nm. 122

17 kolumnowa chromatografia cieczowa.qxp :43 Page CHROMATOGRAFIA ODDZIA YWAÑ HYDROFOBOWYCH Nale y zwróciæ uwagê na du e znaczenie chromatografii oddzia³ywañ hydrofobowych (HIC - Hydrophobic interaction Chromatography), zarówno do wstêpnego monitorowania sk³adu bia³kowego badanego materia³u biologicznego, jak i szczególnie w zastosowaniach preparatywnych. Metoda ta charakteryzuje siê stosunkowo bardzo ³atwym doborem optymalnych warunków rozdzielania. Jako fazê stacjonarn¹ stosuje siê sorbent typu C4, C5, albo C6, niekiedy C8, albo ze zwi¹zanymi grupami fenylowymi. Nale y zapewniæ odpowiedni zakres wielkoœci porów (300 A, albo wiêksze). Program elucji polega na ustaleniu optymalnej i sta³ej wartoœci ph eluentu oraz na stopniowym, albo gradientowym obni aniu stê enia soli w eluencie, w zakresie od wysokiego stê enia - bliskiego (jednak ni szego) stê eniu wysalania bia³ek w badanej próbce - do zerowego stê enia soli. W przypadku nieobecnoœci szczególnie silnie hydrofobowych bia³ek, nie ma koniecznoœci dodawania sk³adników organicznych do eluentu i w konsekwencji nie obserwuje siê, raczej zjawisk denaturacji i, co najwa niejsze, praktycznie wszystkie bia³ka opuszczaj¹ kolumnê z wysok¹ wartoœci¹ stopnia odzysku. Nie wszystkie, jednak, bia³ka obecne w badanej próbce zawsze siê rozdzielaj¹, wiêc, nie mo na metody HIC traktowaæ jako metody w pe³ni uniwersalnej. Jednak, nale y j¹ braæ pod uwagê, gdy konieczne jest rozdzielanie bia³ek i peptydów o wysokich masach molekularnych (powy ej 50 tys. Daltonów). Na rys zamieszczono przyk³ad rozdzielania mieszaniny bia³ek z wykorzystaniem warunków oddzia³ywañ hydrofobowych (HIC). Rys 7.9. Przyk³ad zastosowania warunków oddzia³ywañ hydrofobowych (HIC) do rozdzielania bia³ek - aplikacja YMC (Japonia). Warunki: Kolumna YMC-Pack HIC, 4,6x250mm-HIC 03-6 (6µm;300 A); Eluent A - 2,0M (NH 4 ) 2 SO 4 i 0,1M KH 2 PO 4 - ph 6,8; Eluent B - 0,1M KH 2 PO 4 ph 6,8; Program elucji (jak na rysunku): 0-100% B, 30 minut; W=1,0ml/min; Detekcja UV-254 nm; Substancje rozdzielane: 1-Cytochrom C; 2-Mioglobina; 3-β-Lactoglobulina; 4-Rybonucleaza A; 5-Lyzozym; 6-α- Chymotrypsyna; 7-Chymotrypsynogen A. Lini¹ ci¹g³¹ narysowano program elucji. 123

18 kolumnowa chromatografia cieczowa.qxp :43 Page METODY DETEKCJI W CHROMATOGRAFII PEPTYDÓW I BIA EK Do oznaczania peptydów i bia³ek po rozdzieleniu ich w kolumnie chromatograficznej najczêœciej wykorzystywane s¹ detektory spektrofotometryczne w zakresie nadfioletu UV, albo w zakresie widzialnym VIS (po zastosowaniu tzw. derywatyzacji postkolumnowej, ninhydryn¹). Detektory UV stosuje siê w zakresie 215 nm, gdy rozdzielane peptydy zawieraj¹ jedynie chromofory pochodz¹ce od wi¹zañ peptydowych. Gdy w cz¹steczkach peptydów zwarte s¹ struktury aromatyczne, albo mostki disiarczkowe, wykorzystuje siê wy sze d³ugoœci fali ( nm). Gdy rozdzielane peptydy / bia³ka wystêpuj¹ w œladowych stê eniach wykorzystuje siê fluorescencjê (spowodowan¹ postkolumnowym, albo prekolumnowym zastosowaniem odczynnika derywatyzuj¹cego) i stosuje siê detektor fluoroescencyjny (FLD). Jako odczynniki derywatyzuj¹ce stosuje siê ró ne zwi¹zki lub mieszaniny zwi¹zków, np. kwas jodooctowy z aldehydem o-ftalowym i 2-merkaptoetanolem; 6-aminoquinolyl-N-hydroksysuccinimidyl carbamate; czy dialdehyd o-ftalowy. Detekcja fluorescencyjna jest bardzo specyficzna, wiele razy czulsza od detekcji spektrofotometrycznej. Coraz powszechniej wykorzystywane s¹ spektrometry mas w po³¹czeniu LC-MS i LC-MS-MS, szczególnie do detekcji i oznaczenia masy molekularnej ma³ych peptydów i fragmentów bia³ek o niskim stê eniu w badanej próbce w, burzliwie rozwijaj¹cej siê, proteomice. Zastosowanie w analityce œladowych zawartoœci peptydów znajduj¹ te detektory elektrochemiczne PODSUMOWANIE Przez wiele lat wykorzystywania chromatografii cieczowej do rozdzielania peptydów i bia³ek uda³o siê opracowaæ szereg metod rozdzielania tych substancji i ró nych sposobów wp³ywania na retencjê w kolumnie chromatograficznej. Jednak, nie opracowano dotychczas ogólnych regu³ racjonalnego doboru warunków rozdzielania w zale noœci od struktury cz¹steczek rozdzielanych peptydów i bia³ek. Nie istnieje te ca³kowicie uniwersalny sposób rozdzielania wszystkich mieszanin peptydów / bia³ek, poniewa elektroforeza elowa nie jest przydatna do rozdzielania peptydów o niskich masach cz¹steczkowych, a elektroforeza kapilarna ci¹gle jeszcze nie jest w pe³ni wdro ona do zastosowañ dla peptydów i bia³ek. W konsekwencji metody chromatografii cieczowej stanowi¹ bardzo cenne uzupe³nienie metod rozdzielania i oznaczania, szczególnie peptydów o niskich masach cz¹steczkowych. S¹ to moleku³y o skomplikowanej, wielocz³onowej budowie, a ich zachowanie chromatograficzne bywa czêsto dalekie od utartych regu³ i pogl¹dów. Nieocenione znaczenie ma chromatografia cieczowa dla otrzymywania peptydów i bia³ek, tak w skali preparatywnej, jak i produkcyjnej. Trzeba mieæ œwiadomoœæ, e trudny mo e byæ dobór takich warunków wyodrêbniania peptydów / bia³ek, aby zachowaæ w pe³ni aktywnoœæ biologiczn¹ izolowanej substancji. 124

7. KOLUMNOWA CHROMATOGRAFIA CIECZOWA W ROZDZIELANIU PEPTYDÓW I BIA EK

7. KOLUMNOWA CHROMATOGRAFIA CIECZOWA W ROZDZIELANIU PEPTYDÓW I BIA EK kolumnowa chromatografia cieczowa.qxp 2004-06-15 23:20 Page 105 7. KOLUMNOWA W ROZDZIELANIU PEPTYDÓW I BIA EK Daniel Jastrzêbski, Marian Kamiñski 7.1. WPROWADZENIE Peptydy i bia³ka maj¹ ogromne znaczenie

Bardziej szczegółowo

CHROMATOGRAFIA W UKŁADACH FAZ ODWRÓCONYCH RP-HPLC

CHROMATOGRAFIA W UKŁADACH FAZ ODWRÓCONYCH RP-HPLC CHROMATOGRAFIA W UKŁADACH FAZ ODWRÓCONYCH RP-HPLC MK-EG-AS Wydział Chemiczny Politechniki Gdańskiej Gdańsk 2009 Chromatograficzne układy faz odwróconych (RP) Potocznie: Układy chromatograficzne, w których

Bardziej szczegółowo

Daniel Jastrzębski 1,2, GraŜyna Romanik 1, Marcin M. Kamiński 3, Maciej Trznadel 1, Anita Skrzypczak 1, Aleksandra Królicka 4, Marian Kamiński 1,

Daniel Jastrzębski 1,2, GraŜyna Romanik 1, Marcin M. Kamiński 3, Maciej Trznadel 1, Anita Skrzypczak 1, Aleksandra Królicka 4, Marian Kamiński 1, KOLUMNOWA CHROMATOGRAFIA CIECZOWA W ROZDZIELANIU PEPTYDÓW I BIAŁEK Daniel Jastrzębski 1,2, GraŜyna Romanik 1, Marcin M. Kamiński 3, Maciej Trznadel 1, Anita Skrzypczak 1, Aleksandra Królicka 4, Marian

Bardziej szczegółowo

Instrukcja do ćwiczeń laboratoryjnych

Instrukcja do ćwiczeń laboratoryjnych UNIWERSYTET GDAŃSKI WYDZIAŁ CHEMII Pracownia studencka Katedra Analizy Środowiska Instrukcja do ćwiczeń laboratoryjnych Ćwiczenie nr 2 OPTYMALIZACJA ROZDZIELANIA MIESZANINY WYBRANYCH FARMACEUTYKÓW METODĄ

Bardziej szczegółowo

1. PODSTAWOWE PARAMETRY OPISUJ CE UK AD CHROMATOGRAFICZNY

1. PODSTAWOWE PARAMETRY OPISUJ CE UK AD CHROMATOGRAFICZNY Podstawowe parametry opisujace uklad.qxp 2004-06-15 23:16 Page 7 1. PODSTAWOWE PARAMETRY OPISUJ CE UK AD CHROMATOGRAFICZNY Bogumi³a Makuch, Marian Kamiñski Chromatografia jest technik¹ rozdzielania mieszanin

Bardziej szczegółowo

HPLC? HPLC cz.1. Analiza chromatograficzna. Klasyfikacja metod chromatograficznych

HPLC? HPLC cz.1. Analiza chromatograficzna. Klasyfikacja metod chromatograficznych HPLC cz.1 ver. 1.0 Literatura: 1. Witkiewicz Z. Podstawy chromatografii 2. Szczepaniak W., Metody instrumentalne w analizie chemicznej 3. Snyder L.R., Kirkland J.J., Glajch J.L. Practical HPLC Method Development

Bardziej szczegółowo

Chromatografia kolumnowa planarna

Chromatografia kolumnowa planarna Chromatografia kolumnowa planarna Znaczenie chromatografii w analizie i monitoringu środowiska lotne zanieczyszczenia organiczne (alifatyczne, aromatyczne) w powietrzu, glebie, wodzie Mikrozanieczyszczenia

Bardziej szczegółowo

Zakres zastosowań chromatografii wykluczania

Zakres zastosowań chromatografii wykluczania Zakres zastosowań chromatografii wykluczania CHROMATOGRAFIA WYKLUCZANIA (dawniej żelowa PC/SEC) prof. M. Kamiński WCh-PG Gdańsk, 2013 - Badanie rozkładu masy molekularnej różnego typu materiałów polimerów

Bardziej szczegółowo

-- w części przypomnienie - Gdańsk 2010

-- w części przypomnienie - Gdańsk 2010 Chromatografia cieczowa jako technika analityki, przygotowania próbek, wsadów do rozdzielania, technika otrzymywania grup i czystych substancji Cz. 4. --mechanizmy retencji i selektywności -- -- w części

Bardziej szczegółowo

PP7: Wymiana jonowa i chromatografia jonowymienna oznaczanie kationów i anionów

PP7: Wymiana jonowa i chromatografia jonowymienna oznaczanie kationów i anionów PP7: Wymiana jonowa i chromatografia jonowymienna oznaczanie kationów i anionów Instrukcja do ćwiczeń laboratoryjnych - ćwiczenie nr 7 przedmiot: Metody Analizy Technicznej kierunek studiów: Technologia

Bardziej szczegółowo

1 FILTR. Jak usun¹æ 5 zanieczyszczeñ za pomoc¹ jednego z³o a? PROBLEMÓW Z WOD ROZWI ZUJE. NOWATORSKIE uzdatnianie wody 5 w 1

1 FILTR. Jak usun¹æ 5 zanieczyszczeñ za pomoc¹ jednego z³o a? PROBLEMÓW Z WOD ROZWI ZUJE. NOWATORSKIE uzdatnianie wody 5 w 1 Jak usun¹æ 5 zanieczyszczeñ za pomoc¹ jednego z³o a? 1 FILTR ROZWI ZUJE PROBLEMÓW Z WOD 1 TWARDOŒÆ 2 ELAZO 3 MANGAN 4 AMONIAK 5 ORGANIKA Zanieczyszczenia takie jak: twardoœæ, mangan, elazo, naturalne substancje

Bardziej szczegółowo

masy cząsteczkowej polimerów nisko i średnio polarnych, a także lipidów, fosfolipidów itp.. silanizowanyżel krzemionkowy

masy cząsteczkowej polimerów nisko i średnio polarnych, a także lipidów, fosfolipidów itp.. silanizowanyżel krzemionkowy CHROMATOGRAFIA WYKLUCZANIA (dawniej ŻELOWA PC/SEC) Układy chromatograficzne typu GPC / SEC 1. W warunkach nie-wodnych - eluenty: THF, dioksan, czerochloroetylen, chlorobenzen, ksylen; fazy stacjonarne:

Bardziej szczegółowo

spektroskopia UV Vis (cz. 2)

spektroskopia UV Vis (cz. 2) spektroskopia UV Vis (cz. 2) spektroskopia UV-Vis dlaczego? wiele związków organicznych posiada chromofory, które absorbują w zakresie UV duża czułość: zastosowanie w badaniach kinetyki reakcji spektroskop

Bardziej szczegółowo

Od redakcji. Symbolem oznaczono zadania wykraczające poza zakres materiału omówionego w podręczniku Fizyka z plusem cz. 2.

Od redakcji. Symbolem oznaczono zadania wykraczające poza zakres materiału omówionego w podręczniku Fizyka z plusem cz. 2. Od redakcji Niniejszy zbiór zadań powstał z myślą o tych wszystkich, dla których rozwiązanie zadania z fizyki nie polega wyłącznie na mechanicznym przekształceniu wzorów i podstawieniu do nich danych.

Bardziej szczegółowo

Metody chromatograficzne w chemii i biotechnologii, wykład 3. Łukasz Berlicki

Metody chromatograficzne w chemii i biotechnologii, wykład 3. Łukasz Berlicki Metody chromatograficzne w chemii i biotechnologii, wykład 3 Łukasz Berlicki Rozdział chromatograficzny Przepływ Faza ruchoma mieszanina Faza stacjonarna Chromatografia cieczowa adsorbcyjna Faza stacjonarna:

Bardziej szczegółowo

Instrukcja ćwiczenia laboratoryjnego HPLC-2 Nowoczesne techniki analityczne

Instrukcja ćwiczenia laboratoryjnego HPLC-2 Nowoczesne techniki analityczne Instrukcja ćwiczenia laboratoryjnego HPLC-2 Nowoczesne techniki analityczne 1) OZNACZANIE ROZKŁADU MASY CZĄSTECZKOWEJ POLIMERÓW Z ASTOSOWANIEM CHROMATOGRAFII ŻELOWEJ; 2) PRZYGOTOWANIE PRÓBKI Z ZASTOSOWANIEM

Bardziej szczegółowo

3.2 Warunki meteorologiczne

3.2 Warunki meteorologiczne Fundacja ARMAAG Raport 1999 3.2 Warunki meteorologiczne Pomiary podstawowych elementów meteorologicznych prowadzono we wszystkich stacjach lokalnych sieci ARMAAG, równolegle z pomiarami stê eñ substancji

Bardziej szczegółowo

Wykorzystanie techniki SPE do oczyszczania ekstraktu.. Agata Kot-Wasik

Wykorzystanie techniki SPE do oczyszczania ekstraktu.. Agata Kot-Wasik Wykorzystanie techniki SPE do oczyszczania ekstraktu dr in. Agata Kot-Wasik CEL PRZYGOTOWANIA PRÓBKI Głównym celem przygotowania próbki jest: selektywna izolacja analitów; wzbogacanie; frakcjonowanie;

Bardziej szczegółowo

Wpływ ilości modyfikatora na współczynnik retencji w technice wysokosprawnej chromatografii cieczowej

Wpływ ilości modyfikatora na współczynnik retencji w technice wysokosprawnej chromatografii cieczowej Wpływ ilości modyfikatora na współczynnik retencji w technice wysokosprawnej chromatografii cieczowej WPROWADZENIE Wysokosprawna chromatografia cieczowa (HPLC) jest uniwersalną techniką analityczną, stosowaną

Bardziej szczegółowo

gdy wielomian p(x) jest podzielny bez reszty przez trójmian kwadratowy x rx q. W takim przypadku (5.10)

gdy wielomian p(x) jest podzielny bez reszty przez trójmian kwadratowy x rx q. W takim przypadku (5.10) 5.5. Wyznaczanie zer wielomianów 79 gdy wielomian p(x) jest podzielny bez reszty przez trójmian kwadratowy x rx q. W takim przypadku (5.10) gdzie stopieñ wielomianu p 1(x) jest mniejszy lub równy n, przy

Bardziej szczegółowo

GraŜyna Chwatko Zakład Chemii Środowiska

GraŜyna Chwatko Zakład Chemii Środowiska Chromatografia podstawa metod analizy laboratoryjnej GraŜyna Chwatko Zakład Chemii Środowiska Chromatografia gr. chromatos = barwa grapho = pisze Michaił Siemionowicz Cwiet 2 Chromatografia jest metodą

Bardziej szczegółowo

MATERIAŁY DO ĆWICZEŃ LABORATORYJNYCH - CHROMATOGRAFIA JONOWA

MATERIAŁY DO ĆWICZEŃ LABORATORYJNYCH - CHROMATOGRAFIA JONOWA MATERIAŁY DO ĆWICZEŃ LABORATORYJNYCH - CHROMATOGRAFIA JONOWA mgr inż. Malwina Diduch mgr inż. Ewa Olkowska 1. WPROWADZENIE Termin chromatografia obejmuje wiele technik fizykochemicznych ogólnie zdefiniowanych

Bardziej szczegółowo

RJC. 1 Kwasy i Zasady. Kwasy i zasady Brønsteda Stabilizacja Rezonansowa Kwasy i Zasady Lewisa HA + B: A - + BH + Slides 1 to 35

RJC. 1 Kwasy i Zasady. Kwasy i zasady Brønsteda Stabilizacja Rezonansowa Kwasy i Zasady Lewisa HA + B: A - + BH + Slides 1 to 35 1 Kwasy i Zasady Kwasy i zasady Brønsteda Stabilizacja Rezonansowa Kwasy i Zasady Lewisa HA + B: A - + BH + Slides 1 to 35 2 Kwas : Definicja Brønsteda Kwasem jest taki związek zek chemiczny, który moŝe

Bardziej szczegółowo

Informacje uzyskiwane dzięki spektrometrii mas

Informacje uzyskiwane dzięki spektrometrii mas Slajd 1 Spektrometria mas i sektroskopia w podczerwieni Slajd 2 Informacje uzyskiwane dzięki spektrometrii mas Masa cząsteczkowa Wzór związku Niektóre informacje dotyczące wzoru strukturalnego związku

Bardziej szczegółowo

Prof. dr hab. inż. M. Kamiński aktualizacja : Techniki rozdzielania mieszanin w biotechnologii zagadnienia, pytania

Prof. dr hab. inż. M. Kamiński aktualizacja : Techniki rozdzielania mieszanin w biotechnologii zagadnienia, pytania Prof. dr hab. inż. M. Kamiński aktualizacja : 6-12-2010 Techniki rozdzielania mieszanin w biotechnologii zagadnienia, pytania 1. Zakresy zastosowań technik rozdzielania do przygotowania próbek / wsadów

Bardziej szczegółowo

Materialy do cwiczenia:

Materialy do cwiczenia: Podstawowy kurs chromatografii gazowej / Materialy do cwiczenia: / Optymalizacja procesu rozdzielania analitów I. Teoria Symbol Objaœnienie Uwagi R Rozdzielczoœæ, zdolnoœæ rozdzielcza (ang. Resolution

Bardziej szczegółowo

POMIAR STRUMIENIA PRZEP YWU METOD ZWÊ KOW - KRYZA.

POMIAR STRUMIENIA PRZEP YWU METOD ZWÊ KOW - KRYZA. POMIAR STRUMIENIA PRZEP YWU METOD ZWÊ KOW - KRYZA. Do pomiaru strumienia przep³ywu w rurach metod¹ zwê kow¹ u ywa siê trzech typów zwê ek pomiarowych. S¹ to kryzy, dysze oraz zwê ki Venturiego. (rysunek

Bardziej szczegółowo

Pytania z Wysokosprawnej chromatografii cieczowej

Pytania z Wysokosprawnej chromatografii cieczowej Pytania z Wysokosprawnej chromatografii cieczowej 1. Jak wpłynie 50% dodatek MeOH do wody na retencję kwasu propionowego w układzie faz odwróconych? 2. Jaka jest kolejność retencji kwasów mrówkowego, octowego

Bardziej szczegółowo

PRZEWODNIK PO PRZEDMIOCIE

PRZEWODNIK PO PRZEDMIOCIE Nazwa przedmiotu: Kierunek: Inżynieria Biomedyczna Rodzaj przedmiotu: obowiązkowy moduł kierunkowy ogólny Rodzaj zajęć: wykład, ćwiczenia, laboratorium CHEMIA Chemistry Forma studiów: studia stacjonarne

Bardziej szczegółowo

Szczegółowe informacje na temat gumy, rodzajów gumy oraz jej produkcji można znaleźć w Wikipedii pod adresem:

Szczegółowe informacje na temat gumy, rodzajów gumy oraz jej produkcji można znaleźć w Wikipedii pod adresem: GUMA. To rozciągliwy materiał, elastomer chemicznie zbudowany z alifatycznych łańcuchów polimerowych (np. poliolefin), które są w stosunkowo niewielkim stopniu usieciowane w procesie wulkanizacji kauczuku

Bardziej szczegółowo

Spektroskopia UV-VIS zagadnienia

Spektroskopia UV-VIS zagadnienia Spektroskopia absorbcyjna to dziedzina, która obejmuje metody badania materii przy użyciu promieniowania elektromagnetycznego, które może z tą materią oddziaływać. Spektroskopia UV-VS zagadnienia promieniowanie

Bardziej szczegółowo

Nawiewnik NSL 2-szczelinowy.

Nawiewnik NSL 2-szczelinowy. Nawiewniki i wywiewniki szczelinowe NSL NSL s¹ przeznaczone do zastosowañ w instalacjach wentylacyjnych nisko- i œredniociœnieniowych, o sta³ym lub zmiennym przep³ywie powietrza. Mog¹ byæ montowane w sufitach

Bardziej szczegółowo

PRAWA ZACHOWANIA. Podstawowe terminy. Cia a tworz ce uk ad mechaniczny oddzia ywuj mi dzy sob i z cia ami nie nale cymi do uk adu za pomoc

PRAWA ZACHOWANIA. Podstawowe terminy. Cia a tworz ce uk ad mechaniczny oddzia ywuj mi dzy sob i z cia ami nie nale cymi do uk adu za pomoc PRAWA ZACHOWANIA Podstawowe terminy Cia a tworz ce uk ad mechaniczny oddzia ywuj mi dzy sob i z cia ami nie nale cymi do uk adu za pomoc a) si wewn trznych - si dzia aj cych na dane cia o ze strony innych

Bardziej szczegółowo

13. PREPARATYWNA I PROCESOWA CHROMATOGRAFIA CIECZOWA

13. PREPARATYWNA I PROCESOWA CHROMATOGRAFIA CIECZOWA preparatywna i procesowa chromatografia cieczowa.qxp 2004-06-16 23:59 Page 192 13. PREPARATYWNA I PROCESOWA CHROMATOGRAFIA CIECZOWA Marian Kamiñski 13.1. WPROWADZENIE Chromatografia cieczowa to nie tylko

Bardziej szczegółowo

Techniki Rozdzielania Mieszanin

Techniki Rozdzielania Mieszanin Techniki Rozdzielania Mieszanin Techniki Sorpcji i Chromatografii cz. I prof. dr hab. inż. Marian Kamiński Gdańsk 2010 Chromatografia cieczowa jako technika analityki, przygotowania próbek, wsadów do rozdzielania,

Bardziej szczegółowo

Cz. 5. Podstawy instrumentalizacji chromatografii. aparatura chromatograficzna w skali analitycznej i modelowej - -- w części przypomnienie -

Cz. 5. Podstawy instrumentalizacji chromatografii. aparatura chromatograficzna w skali analitycznej i modelowej - -- w części przypomnienie - Chromatografia cieczowa jako technika analityki, przygotowania próbek, wsadów do rozdzielania, technika otrzymywania grup i czystych substancji Cz. 5. Podstawy instrumentalizacji chromatografii aparatura

Bardziej szczegółowo

TEORIE KWASÓW I ZASAD.

TEORIE KWASÓW I ZASAD. TERIE KWASÓW I ZASAD. Teoria Arrheniusa (nagroda Nobla 1903 r). Kwas kaŝda substancja, która dostarcza jony + do roztworu. A + + A Zasada kaŝda substancja, która dostarcza jony do roztworu. M M + + Reakcja

Bardziej szczegółowo

Zastosowanie chromatografii cieczowej w biotechnologii środowiskowej

Zastosowanie chromatografii cieczowej w biotechnologii środowiskowej Zastosowanie chromatografii cieczowej w biotechnologii środowiskowej Projekt współfinansowany przez Unię Europejską w ramach Europejskiego Funduszu Społecznego Literatura: 1. R. Rosset, H. Kołodziejczyk;

Bardziej szczegółowo

ze stabilizatorem liniowym, powoduje e straty cieplne s¹ ma³e i dlatego nie jest wymagany aden radiator. DC1C

ze stabilizatorem liniowym, powoduje e straty cieplne s¹ ma³e i dlatego nie jest wymagany aden radiator. DC1C D D 9 Warszawa ul. Wolumen m. tel. ()9 email: biuro@jsel.pl www.jselektronik.pl PRZETWORNIA NAPIÊIA STA EGO D (max. A) W AŒIWOŒI Napiêcie wejœciowe do V. Typowe napiêcia wyjœciowe V, V, 7V, 9V, V,.8V,

Bardziej szczegółowo

DZIA 4. POWIETRZE I INNE GAZY

DZIA 4. POWIETRZE I INNE GAZY DZIA 4. POWIETRZE I INNE GAZY 1./4 Zapisz nazwy wa niejszych sk³adników powietrza, porz¹dkuj¹c je wed³ug ich malej¹cej zawartoœci w powietrzu:...... 2./4 Wymieñ trzy wa ne zastosowania tlenu: 3./4 Oblicz,

Bardziej szczegółowo

Lekcja 173, 174. Temat: Silniki indukcyjne i pierścieniowe.

Lekcja 173, 174. Temat: Silniki indukcyjne i pierścieniowe. Lekcja 173, 174 Temat: Silniki indukcyjne i pierścieniowe. Silnik elektryczny asynchroniczny jest maszyną elektryczną zmieniającą energię elektryczną w energię mechaniczną, w której wirnik obraca się z

Bardziej szczegółowo

Znaczenie i zastosowania chromatografii oraz rodzaje technik chromatograficznych

Znaczenie i zastosowania chromatografii oraz rodzaje technik chromatograficznych Marian Kamiński PODSTAWOWE POJĘCIA I PARAMETRY OPISUJĄCE UKŁADY CHROMATOGRAFICZNE. PODSTAWOWE ZASADY EFEKTYWNEGO STOSOWANIA CHROMATOGRAFII CIECZOWEJ DO ROZDZIELANIA I OZNACZANIA SKŁADU MIESZANIN Znaczenie

Bardziej szczegółowo

3. CHROMATOGRAFIA W UK ADZIE FAZ ODWRÓCONYCH

3. CHROMATOGRAFIA W UK ADZIE FAZ ODWRÓCONYCH chromatografia w fazach odwroconych.qxp 2004-06-15 23:17 Page 30 3. CHROMATOGRAFIA W UK ADZIE FAZ ODWRÓCONYCH Krystyna Gazda 3.1. DEFINICJA Uk³ad faz odwróconych (RP), to taki uk³ad, w którym faza stacjonarna

Bardziej szczegółowo

2.Prawo zachowania masy

2.Prawo zachowania masy 2.Prawo zachowania masy Zdefiniujmy najpierw pewne podstawowe pojęcia: Układ - obszar przestrzeni o określonych granicach Ośrodek ciągły - obszar przestrzeni którego rozmiary charakterystyczne są wystarczająco

Bardziej szczegółowo

Techniki korekcyjne wykorzystywane w metodzie kinesiotapingu

Techniki korekcyjne wykorzystywane w metodzie kinesiotapingu Techniki korekcyjne wykorzystywane w metodzie kinesiotapingu Jak ju wspomniano, kinesiotaping mo e byç stosowany jako osobna metoda terapeutyczna, jak równie mo e stanowiç uzupe nienie innych metod fizjoterapeutycznych.

Bardziej szczegółowo

Chemia i technologia materiałów barwnych BADANIE WŁAŚCIWOŚCI ZWIĄZKÓW BARWNYCH WYKORZYSTANIEM SPEKTROFOTOMETRII UV-VIS.

Chemia i technologia materiałów barwnych BADANIE WŁAŚCIWOŚCI ZWIĄZKÓW BARWNYCH WYKORZYSTANIEM SPEKTROFOTOMETRII UV-VIS. Chemia i technologia materiałów barwnych Ćwiczenia laboratoryjne BADANIE WŁAŚCIWOŚCI ZWIĄZKÓW BARWNYCH WYKORZYSTANIEM SPEKTROFOTOMETRII UV-VIS. Z Opracowanie: dr inŝ. Ewa Wagner-Wysiecka Politechnika Gdańska

Bardziej szczegółowo

Lp. Tematyka Liczba godzin I. Wymagania edukacyjne

Lp. Tematyka Liczba godzin I. Wymagania edukacyjne Anna Ulrych Plan wynikowy Przedmiot: Materiały fryzjerskie Kierunek : Technikum Usług Fryzjerskich- rok szkolny 05/ 06 Liczba godzin: 76 Liczba godzin w roku szkolnym: KL.II Lp. Tematyka Liczba godzin

Bardziej szczegółowo

Gruntowy wymiennik ciepła PROVENT- GEO

Gruntowy wymiennik ciepła PROVENT- GEO Gruntowy wymiennik ciepła PROVENT- GEO Bezprzeponowy Płytowy Gruntowy Wymiennik Ciepła PROVENT-GEO to unikatowe, oryginalne rozwiązanie umożliwiające pozyskanie zawartego gruncie chłodu latem oraz ciepła

Bardziej szczegółowo

OFERTA TEMATÓW PROJEKTÓW DYPLOMOWYCH (MAGISTERSKICH) do zrealizowania w Katedrze INŻYNIERII CHEMICZNEJ I PROCESOWEJ

OFERTA TEMATÓW PROJEKTÓW DYPLOMOWYCH (MAGISTERSKICH) do zrealizowania w Katedrze INŻYNIERII CHEMICZNEJ I PROCESOWEJ OFERTA TEMATÓW PROJEKTÓW DYPLOMOWYCH (MAGISTERSKICH) do zrealizowania w Katedrze INŻYNIERII CHEMICZNEJ I PROCESOWEJ Badania kinetyki utleniania wybranych grup związków organicznych podczas procesów oczyszczania

Bardziej szczegółowo

ROZDZIELENIE OD PODSTAW czyli wszystko (?) O KOLUMNIE CHROMATOGRAFICZNEJ

ROZDZIELENIE OD PODSTAW czyli wszystko (?) O KOLUMNIE CHROMATOGRAFICZNEJ ROZDZIELENIE OD PODSTAW czyli wszystko (?) O KOLUMNIE CHROMATOGRAFICZNEJ Prof. dr hab. inż. Agata Kot-Wasik Katedra Chemii Analitycznej Wydział Chemiczny, Politechnika Gdańska agawasik@pg.gda.pl ROZDZIELENIE

Bardziej szczegółowo

WARSZTATY olimpijskie. Co już było: Atomy i elektrony Cząsteczki i wiązania Stechiometria Gazy, termochemia Równowaga chemiczna Kinetyka

WARSZTATY olimpijskie. Co już było: Atomy i elektrony Cząsteczki i wiązania Stechiometria Gazy, termochemia Równowaga chemiczna Kinetyka WARSZTATY olimpijskie Co już było: Atomy i elektrony Cząsteczki i wiązania Stechiometria Gazy, termochemia Równowaga chemiczna inetyka WARSZTATY olimpijskie Co będzie: Data Co robimy 1 XII 2016 wasy i

Bardziej szczegółowo

ZAPYTANIE OFERTOWE. Tłumaczenie pisemne dokumentacji rejestracyjnej ZAPYTANIE OFERTOWE

ZAPYTANIE OFERTOWE. Tłumaczenie pisemne dokumentacji rejestracyjnej ZAPYTANIE OFERTOWE ZAPYTANIE OFERTOWE Tłumaczenie pisemne dokumentacji rejestracyjnej Biofarm sp. z o.o. ul. Wałbrzyska 13 60-198 Poznań Poznań, 09 grudnia 2015r. ZAPYTANIE OFERTOWE I. Nazwa i adres Zamawiającego: Biofarm

Bardziej szczegółowo

PODSTAWY OBLICZEŃ CHEMICZNYCH DLA MECHANIKÓW

PODSTAWY OBLICZEŃ CHEMICZNYCH DLA MECHANIKÓW PODSTAWY OBLICZEŃ CHEMICZNYCH DLA MECHANIKÓW Opracowanie: dr inż. Krystyna Moskwa, dr Wojciech Solarski 1. Termochemia. Każda reakcja chemiczna związana jest z wydzieleniem lub pochłonięciem energii, najczęściej

Bardziej szczegółowo

Przedmowa Czêœæ pierwsza. Podstawy frontalnych automatów komórkowych... 11

Przedmowa Czêœæ pierwsza. Podstawy frontalnych automatów komórkowych... 11 Spis treœci Przedmowa... 9 Czêœæ pierwsza. Podstawy frontalnych automatów komórkowych... 11 1. Wstêp... 13 1.1. Rys historyczny... 14 1.2. Klasyfikacja automatów... 18 1.3. Automaty komórkowe a modelowanie

Bardziej szczegółowo

Jolanta Jaroszewska-Manaj 1. i identyfikacji związków organicznych. Jolanta Jaroszewska-Manaj 2

Jolanta Jaroszewska-Manaj 1. i identyfikacji związków organicznych. Jolanta Jaroszewska-Manaj 2 Jolanta Jaroszewska-Manaj 1 1 Chromatograficzne metody rozdzielania i identyfikacji związków organicznych Jolanta Jaroszewska-Manaj 2 Jolanta Jaroszewska-Manaj 3 Jolanta Jaroszewska-Manaj 4 Jolanta Jaroszewska-Manaj

Bardziej szczegółowo

PREPARATYWNA I PROCESOWA CHROMATOGRAFIA CIECZOWA

PREPARATYWNA I PROCESOWA CHROMATOGRAFIA CIECZOWA Marian KAMI SKI Politechnika Gda ska, Wydzia Chemiczny, 80-233 Gda sk, ul. Narutowicza 11/12, e-mail: mknkj@chem.pg.gda.pl.; tel: 601-40-18-24, (058) 347-17-29 PREPARATYWNA I PROCESOWA CHROMATOGRAFIA CIECZOWA

Bardziej szczegółowo

Klasyfikacja i oznakowanie substancji chemicznych i ich mieszanin. Dominika Sowa

Klasyfikacja i oznakowanie substancji chemicznych i ich mieszanin. Dominika Sowa Klasyfikacja i oznakowanie substancji chemicznych i ich mieszanin Dominika Sowa Szczecin, 8 maj 2014 Program prezentacji: 1. Definicja substancji i mieszanin chemicznych wg Ustawy o substancjach chemicznych

Bardziej szczegółowo

6. CHROMATOGRAFIA JONOWYMIENNA I JONOWA

6. CHROMATOGRAFIA JONOWYMIENNA I JONOWA Chromatografia jonowa i jonowymienna.qxp 2004-06-15 23:19 Page 83 6. CHROMATOGRAFIA JONOWYMIENNA I JONOWA Marian Kamiñski 6.1. SKRÓT Zastosowanie: Rozdzielanie i oznaczanie nieorganicznych, albo organicznych

Bardziej szczegółowo

Prof. dr hab. inż. M. Kamiński 2006/7 Katedra Chemii Analitycznej Wydział Chemiczny PG. Ćwiczenie: LC / GC. Instrukcja ogólna

Prof. dr hab. inż. M. Kamiński 2006/7 Katedra Chemii Analitycznej Wydział Chemiczny PG. Ćwiczenie: LC / GC. Instrukcja ogólna Prof. dr hab. inż. M. Kamiński 2006/7 Katedra Chemii Analitycznej Wydział Chemiczny PG Przedmiot: Chemia analityczna Instrukcje ćwiczeń laboratoryjnych Ćwiczenie: LC / GC Instrukcja ogólna Uzupełniający

Bardziej szczegółowo

KONKURS CHEMICZNY DLA UCZNIÓW GIMNAZJÓW

KONKURS CHEMICZNY DLA UCZNIÓW GIMNAZJÓW KONKURS CHEMICZNY DLA UCZNIÓW GIMNAZJÓW WOJEWÓDZTWO WIELKOPOLSKIE Etap wojewódzki rok szkolny 2009/2010 Dane dotyczące ucznia (wypełnia Komisja Konkursowa po rozkodowaniu prac) wylosowany numer uczestnika

Bardziej szczegółowo

Slajd 1. Slajd 2. Proteiny. Peptydy i białka są polimerami aminokwasów połączonych wiązaniem amidowym (peptydowym) Kwas α-aminokarboksylowy aminokwas

Slajd 1. Slajd 2. Proteiny. Peptydy i białka są polimerami aminokwasów połączonych wiązaniem amidowym (peptydowym) Kwas α-aminokarboksylowy aminokwas Slajd 1 Proteiny Slajd 2 Peptydy i białka są polimerami aminokwasów połączonych wiązaniem amidowym (peptydowym) wiązanie amidowe Kwas α-aminokarboksylowy aminokwas Slajd 3 Aminokwasy z alifatycznym łańcuchem

Bardziej szczegółowo

(wymiar macierzy trójk¹tnej jest równy liczbie elementów na g³ównej przek¹tnej). Z twierdzen 1 > 0. Zatem dla zale noœci

(wymiar macierzy trójk¹tnej jest równy liczbie elementów na g³ównej przek¹tnej). Z twierdzen 1 > 0. Zatem dla zale noœci 56 Za³ó my, e twierdzenie jest prawdziwe dla macierzy dodatnio okreœlonej stopnia n 1. Macierz A dodatnio okreœlon¹ stopnia n mo na zapisaæ w postaci n 1 gdzie A n 1 oznacza macierz dodatnio okreœlon¹

Bardziej szczegółowo

Kwas HA i odpowiadająca mu zasada A stanowią sprzężoną parę (podobnie zasada B i kwas BH + ):

Kwas HA i odpowiadająca mu zasada A stanowią sprzężoną parę (podobnie zasada B i kwas BH + ): Spis treści 1 Kwasy i zasady 2 Rola rozpuszczalnika 3 Dysocjacja wody 4 Słabe kwasy i zasady 5 Skala ph 6 Oblicznie ph słabego kwasu 7 Obliczanie ph słabej zasady 8 Przykłady obliczeń 81 Zadanie 1 811

Bardziej szczegółowo

1. Wprowadzenie ZASTOSOWANIE PROCESU WYMIANY JONOWEJ DO OCZYSZCZANIA ŒCIEKÓW Z PRZEMYS U METALI NIE ELAZNYCH** Dominika Paluch*

1. Wprowadzenie ZASTOSOWANIE PROCESU WYMIANY JONOWEJ DO OCZYSZCZANIA ŒCIEKÓW Z PRZEMYS U METALI NIE ELAZNYCH** Dominika Paluch* Górnictwo i Geoin ynieria Rok 29 Zeszyt 4 2005 Dominika Paluch* ZASTOSOWANIE PROCESU WYMIANY JONOWEJ DO OCZYSZCZANIA ŒCIEKÓW Z PRZEMYS U METALI NIE ELAZNYCH** 1. Wprowadzenie Proces wymiany jonowej znany

Bardziej szczegółowo

WYMAGANIA EDUKACYJNE SPOSOBY SPRAWDZANIA POSTĘPÓW UCZNIÓW WARUNKI I TRYB UZYSKANIA WYŻSZEJ NIŻ PRZEWIDYWANA OCENY ŚRÓDROCZNEJ I ROCZNEJ

WYMAGANIA EDUKACYJNE SPOSOBY SPRAWDZANIA POSTĘPÓW UCZNIÓW WARUNKI I TRYB UZYSKANIA WYŻSZEJ NIŻ PRZEWIDYWANA OCENY ŚRÓDROCZNEJ I ROCZNEJ WYMAGANIA EDUKACYJNE SPOSOBY SPRAWDZANIA POSTĘPÓW UCZNIÓW WARUNKI I TRYB UZYSKANIA WYŻSZEJ NIŻ PRZEWIDYWANA OCENY ŚRÓDROCZNEJ I ROCZNEJ Anna Gutt- Kołodziej ZASADY OCENIANIA Z MATEMATYKI Podczas pracy

Bardziej szczegółowo

Zagadnienia z chemii na egzamin wstępny kierunek Technik Farmaceutyczny Szkoła Policealna im. J. Romanowskiej

Zagadnienia z chemii na egzamin wstępny kierunek Technik Farmaceutyczny Szkoła Policealna im. J. Romanowskiej Zagadnienia z chemii na egzamin wstępny kierunek Technik Farmaceutyczny Szkoła Policealna im. J. Romanowskiej 1) Podstawowe prawa i pojęcia chemiczne 2) Roztwory (zadania rachunkowe zbiór zadań Pazdro

Bardziej szczegółowo

SPEKTROSKOPIA LASEROWA

SPEKTROSKOPIA LASEROWA SPEKTROSKOPIA LASEROWA Spektroskopia laserowa dostarcza wiedzy o naturze zjawisk zachodz cych na poziomie atomów i cz steczek oraz oddzia ywaniu promieniowania z materi i nale y do jednej z najwa niejszych

Bardziej szczegółowo

2. CHROMATOGRAFIA W UK ADACH FAZ NORMALNYCH

2. CHROMATOGRAFIA W UK ADACH FAZ NORMALNYCH chromatografia w ukladzie faz normalnych.qxp 2004-06-15 23:16 Page 16 2. CHROMATOGRAFIA W UK ADACH FAZ NORMALNYCH Bogumi³a Makuch Uk³adem faz normalnych (NP) nazywa siê uk³ad chromatograficzny, w którym

Bardziej szczegółowo

Rys Mo liwe postacie funkcji w metodzie regula falsi

Rys Mo liwe postacie funkcji w metodzie regula falsi 5.3. Regula falsi i metoda siecznych 73 Rys. 5.1. Mo liwe postacie funkcji w metodzie regula falsi Rys. 5.2. Przypadek f (x), f (x) > w metodzie regula falsi 74 V. Równania nieliniowe i uk³ady równañ liniowych

Bardziej szczegółowo

Zarządzanie projektami. wykład 1 dr inż. Agata Klaus-Rosińska

Zarządzanie projektami. wykład 1 dr inż. Agata Klaus-Rosińska Zarządzanie projektami wykład 1 dr inż. Agata Klaus-Rosińska 1 DEFINICJA PROJEKTU Zbiór działań podejmowanych dla zrealizowania określonego celu i uzyskania konkretnego, wymiernego rezultatu produkt projektu

Bardziej szczegółowo

Seminarium 1: 08. 10. 2015

Seminarium 1: 08. 10. 2015 Seminarium 1: 08. 10. 2015 Białka organizmu ok. 15 000 g białka osocza ok. 600 g (4%) Codzienna degradacja ok. 25 g białek osocza w lizosomach, niezależnie od wieku cząsteczki, ale zależnie od poprawności

Bardziej szczegółowo

Stechiometria równań reakcji chemicznych, objętość gazów w warunkach odmiennych od warunków normalnych (0 o C 273K, 273hPa)

Stechiometria równań reakcji chemicznych, objętość gazów w warunkach odmiennych od warunków normalnych (0 o C 273K, 273hPa) Karta pracy I/2a Stechiometria równań reakcji chemicznych, objętość gazów w warunkach odmiennych od warunków normalnych (0 o C 273K, 273hPa) I. Stechiometria równań reakcji chemicznych interpretacja równań

Bardziej szczegółowo

Dr inż. Andrzej Tatarek. Siłownie cieplne

Dr inż. Andrzej Tatarek. Siłownie cieplne Dr inż. Andrzej Tatarek Siłownie cieplne 1 Wykład 3 Sposoby podwyższania sprawności elektrowni 2 Zwiększenie sprawności Metody zwiększenia sprawności elektrowni: 1. podnoszenie temperatury i ciśnienia

Bardziej szczegółowo

Prezentacja dotycząca sytuacji kobiet w regionie Kalabria (Włochy)

Prezentacja dotycząca sytuacji kobiet w regionie Kalabria (Włochy) Prezentacja dotycząca sytuacji kobiet w regionie Kalabria (Włochy) Położone w głębi lądu obszary Kalabrii znacznie się wyludniają. Zjawisko to dotyczy całego regionu. Do lat 50. XX wieku przyrost naturalny

Bardziej szczegółowo

NS4. Anemostaty wirowe. SMAY Sp. z o.o. / ul. Ciep³ownicza 29 / Kraków tel / fax /

NS4. Anemostaty wirowe. SMAY Sp. z o.o. / ul. Ciep³ownicza 29 / Kraków tel / fax / Anemostaty wirowe NS4 Atesty Higieniczne: HK/B/1121/02/2007 HK/B/1121/04/2007 NS4 s¹ przeznaczone do zastosowañ w instalacjach wentylacyjnych nisko- i œredniociœnieniowych. Pozwalaj¹ na uzyskanie nawiewu

Bardziej szczegółowo

OZNACZANIE WAPNIA I MAGNEZU W PRÓBCE WINA METODĄ ATOMOWEJ SPEKTROMETRII ABSORPCYJNEJ Z ATOMIZACJA W PŁOMIENIU

OZNACZANIE WAPNIA I MAGNEZU W PRÓBCE WINA METODĄ ATOMOWEJ SPEKTROMETRII ABSORPCYJNEJ Z ATOMIZACJA W PŁOMIENIU OZNACZANIE WAPNIA I MAGNEZU W PRÓBCE WINA METODĄ ATOMOWEJ SPEKTROMETRII ABSORPCYJNEJ Z ATOMIZACJA W PŁOMIENIU Celem ćwiczenia jest zapoznanie z techniką atomowej spektrometrii absorpcyjnej z atomizacją

Bardziej szczegółowo

DZIA 3. CZENIE SIÊ ATOMÓW

DZIA 3. CZENIE SIÊ ATOMÓW DZIA 3. CZENIE SIÊ ATOMÓW 1./3 Wyjaœnij, w jaki sposób powstaje: a) wi¹zanie jonowe b) wi¹zanie atomowe 2./3 Na podstawie po³o enia w uk³adzie okresowym pierwiastków: chloru i litu ustal, ile elektronów

Bardziej szczegółowo

Oznaczanie właściwości tłuszczów

Oznaczanie właściwości tłuszczów znaczanie właściwości tłuszczów Prowadzący: mgr inż. Maciej Chrubasik Wstęp teoretyczny Lipidy Lipidy ( tłuszcze ) są estrami kwasów tłuszczowych : - gdy alkoholem jest gliceryna ( 1,2,3-trihydroksy propan;

Bardziej szczegółowo

ZASADY WYPEŁNIANIA ANKIETY 2. ZATRUDNIENIE NA CZĘŚĆ ETATU LUB PRZEZ CZĘŚĆ OKRESU OCENY

ZASADY WYPEŁNIANIA ANKIETY 2. ZATRUDNIENIE NA CZĘŚĆ ETATU LUB PRZEZ CZĘŚĆ OKRESU OCENY ZASADY WYPEŁNIANIA ANKIETY 1. ZMIANA GRUPY PRACOWNIKÓW LUB AWANS W przypadku zatrudnienia w danej grupie pracowników (naukowo-dydaktyczni, dydaktyczni, naukowi) przez okres poniżej 1 roku nie dokonuje

Bardziej szczegółowo

KATEDRA INŻYNIERII CHEMICZNEJ I PROCESOWEJ. Ćwiczenie nr 1 INSTRUKCJE DO ĆWICZEŃ LABORATORYJNYCH. Przedmiot: Techniki Rozdzielania Mieszanin

KATEDRA INŻYNIERII CHEMICZNEJ I PROCESOWEJ. Ćwiczenie nr 1 INSTRUKCJE DO ĆWICZEŃ LABORATORYJNYCH. Przedmiot: Techniki Rozdzielania Mieszanin KATEDRA INŻYNIERII CHEMICZNEJ I PROCESOWEJ INSTRUKCJE DO ĆWICZEŃ LABORATORYJNYCH Ćwiczenie nr 1 Przedmiot: Techniki Rozdzielania Mieszanin Kierunek studiów: Biotechnologia, semestr VI, studiów I-go stopnia

Bardziej szczegółowo

HAZE BATTERY Company Ltd. Akumulatory ołowiowo kwasowe szczelne żelowe 12 letnie monobloki 6 i 12V. seria HZY-ŻELOWE

HAZE BATTERY Company Ltd. Akumulatory ołowiowo kwasowe szczelne żelowe 12 letnie monobloki 6 i 12V. seria HZY-ŻELOWE HAZE BATTERY Company Ltd Akumulatory ołowiowo kwasowe szczelne żelowe 12 letnie monobloki 6 i 12V seria HZY-ŻELOWE KONSTRUKCJA - Siatki płyt dodatnich i ujemnych odlewane są z ołowiu wapniowo-cynowego,

Bardziej szczegółowo

Karta przedmiotu. obowiązuje studentów rozpoczynających studia w roku akademickim 2014/2015. Forma studiów: Stacjonarne Kod kierunku: 06.

Karta przedmiotu. obowiązuje studentów rozpoczynających studia w roku akademickim 2014/2015. Forma studiów: Stacjonarne Kod kierunku: 06. Państwowa Wyższa Szko la Zawodowa w Nowym Sa czu Karta przedmiotu Instytut Techniczny obowiązuje studentów rozpoczynających studia w roku akademickim 01/01 Kierunek studiów: Zarządzanie i inżynieria produkcji

Bardziej szczegółowo

KOMISJA WSPÓLNOT EUROPEJSKICH. Wniosek DECYZJA RADY

KOMISJA WSPÓLNOT EUROPEJSKICH. Wniosek DECYZJA RADY KOMISJA WSPÓLNOT EUROPEJSKICH Bruksela, dnia 13.12.2006 KOM(2006) 796 wersja ostateczna Wniosek DECYZJA RADY w sprawie przedłużenia okresu stosowania decyzji 2000/91/WE upoważniającej Królestwo Danii i

Bardziej szczegółowo

Ciśnieniowe techniki membranowe (część 2)

Ciśnieniowe techniki membranowe (część 2) Wykład 5 Ciśnieniowe techniki membranowe (część 2) Opracowała dr Elżbieta Megiel Nanofiltracja (ang. Nanofiltration) NF GMM 200 Da rozmiar molekuły 1 nm, TMM 5 30 atm Membrany jonoselektywne Stopień zatrzymywania:

Bardziej szczegółowo

Chemia Analityczna. Chromatografia. Tłumaczyła: inż. Karolina Hierasimczyk

Chemia Analityczna. Chromatografia. Tłumaczyła: inż. Karolina Hierasimczyk Chemia Analityczna Chromatografia Tłumaczyła: inż. Karolina Hierasimczyk Korekta: dr hab. inż. Waldemar Wardencki, prof. nadzw. PG prof. dr hab. inż. Jacek Namieśnik Część III Kolumny kapilarne do chromatografii

Bardziej szczegółowo

Nowoczesne metody analizy pierwiastków

Nowoczesne metody analizy pierwiastków Nowoczesne metody analizy pierwiastków Techniki analityczne Chromatograficzne Spektroskopowe Chromatografia jonowa Emisyjne Absorpcyjne Fluoroscencyjne Spektroskopia mas FAES ICP-AES AAS EDAX ICP-MS Prezentowane

Bardziej szczegółowo

Ćwiczenie: "Ruch harmoniczny i fale"

Ćwiczenie: Ruch harmoniczny i fale Ćwiczenie: "Ruch harmoniczny i fale" Opracowane w ramach projektu: "Wirtualne Laboratoria Fizyczne nowoczesną metodą nauczania realizowanego przez Warszawską Wyższą Szkołę Informatyki. Zakres ćwiczenia:

Bardziej szczegółowo

Jacek Mrzyg³ód, Tomasz Rostkowski* Rozwi¹zania systemowe zarz¹dzania kapita³em ludzkim (zkl) w bran y energetycznej

Jacek Mrzyg³ód, Tomasz Rostkowski* Rozwi¹zania systemowe zarz¹dzania kapita³em ludzkim (zkl) w bran y energetycznej Komunikaty 99 Jacek Mrzyg³ód, Tomasz Rostkowski* Rozwi¹zania systemowe zarz¹dzania kapita³em ludzkim (zkl) w bran y energetycznej Artyku³ przedstawi skrócony raport z wyników badania popularnoœci rozwi¹zañ

Bardziej szczegółowo

Atom poziom podstawowy

Atom poziom podstawowy Atom poziom podstawowy Zadanie 1. (1 pkt) Źródło: CKE 2010 (PP), zad. 1. Atomy pewnego pierwiastka w stanie podstawowym maj nast puj c konfiguracj elektronów walencyjnych: 2s 2 2p 3 (L 5 ) Okre l po o

Bardziej szczegółowo

NS8. Anemostaty wirowe. z ruchomymi kierownicami

NS8. Anemostaty wirowe. z ruchomymi kierownicami Anemostaty wirowe z ruchomymi kierownicami NS8 NS8 s¹ przeznaczone do zastosowañ w instalacjach wentylacyjnych nisko- i œredniociœnieniowych. Ruchome kierownice pozwalaj¹ na dowolne kszta³towanie strumienia

Bardziej szczegółowo

Nagroda Nobla z fizjologii i medycyny w 2004 r.

Nagroda Nobla z fizjologii i medycyny w 2004 r. Nagroda Nobla z fizjologii i medycyny w 2004 r. Receptory zapachu i organizacja systemu węchowego Takao Ishikawa, M.Sc. Zakład Biologii Molekularnej Instytut Biochemii Uniwersytetu Warszawskiego 10 mln

Bardziej szczegółowo

KOLUMNOWA CHROMATOGRAFIA CIECZOWA W ROZDZIELANIU I ANALIZIE PEPTYDÓW I BIA EK

KOLUMNOWA CHROMATOGRAFIA CIECZOWA W ROZDZIELANIU I ANALIZIE PEPTYDÓW I BIA EK Daniel JASTRZ BSKI 1,2, Gra yna ROMANIK 1, Marcin M. KAMI SKI 3, Maciej TRZNADEL 1, Anita SKRZYPCZAK 1, Aleksandra KRÓLICKA 4, Marian KAMI SKI 1 1) Wydzia Chemiczny Politechniki Gda skiej, Katedra Chemii

Bardziej szczegółowo

Kuratorium Oświaty w Lublinie

Kuratorium Oświaty w Lublinie Kuratorium Oświaty w Lublinie ZESTAW ZADAŃ KONKURSOWYCH Z CHEMII DLA UCZNIÓW GIMNAZJÓW ROK SZKOLNY 2014/2015 KOD UCZNIA ETAP OKRĘGOWY Instrukcja dla ucznia 1. Zestaw konkursowy zawiera 12 zadań. 2. Przed

Bardziej szczegółowo

CENTRUM BADANIA OPINII SPOŁECZNEJ

CENTRUM BADANIA OPINII SPOŁECZNEJ CENTRUM BADANIA OPINII SPOŁECZNEJ SEKRETARIAT OŚRODEK INFORMACJI 629-35 - 69, 628-37 - 04 693-46 - 92, 625-76 - 23 UL. ŻURAWIA 4A, SKR. PT.24 00-503 W A R S Z A W A TELEFAX 629-40 - 89 INTERNET http://www.cbos.pl

Bardziej szczegółowo

Techniczne nauki М.М.Zheplinska, A.S.Bessarab Narodowy uniwersytet spożywczych technologii, Кijow STOSOWANIE PARY WODNEJ SKRAPLANIA KAWITACJI

Techniczne nauki М.М.Zheplinska, A.S.Bessarab Narodowy uniwersytet spożywczych technologii, Кijow STOSOWANIE PARY WODNEJ SKRAPLANIA KAWITACJI Techniczne nauki М.М.Zheplinska, A.S.Bessarab Narodowy uniwersytet spożywczych technologii, Кijow STOSOWANIE PARY WODNEJ SKRAPLANIA KAWITACJI SKLAROWANEGO SOKU JABŁKOWEGO Skutecznym sposobem leczenia soku

Bardziej szczegółowo

Kierunek studiów: Technologia Chemiczna, II-gi etap II-gi semestr. DODATEK do INSTRUKCJI ĆWICZEŃ LABORATORYJNYCH LC-1 i LC-2 -- TR - TCh II/II

Kierunek studiów: Technologia Chemiczna, II-gi etap II-gi semestr. DODATEK do INSTRUKCJI ĆWICZEŃ LABORATORYJNYCH LC-1 i LC-2 -- TR - TCh II/II prof. Marian Kamiński oprac. 6.01.2012., kor. i uzup. : 23-01-15 Kierunek studiów: Technologia Chemiczna, II-gi etap II-gi semestr DODATEK do INSTRUKCJI ĆWICZEŃ LABORATORYJNYCH LC-1 i LC-2 -- TR - TCh

Bardziej szczegółowo

KATEDRA INŻYNIERII CHEMICZNEJ I PROCESOWEJ INSTRUKCJE ĆWICZEŃ LABORATORYJNYCH

KATEDRA INŻYNIERII CHEMICZNEJ I PROCESOWEJ INSTRUKCJE ĆWICZEŃ LABORATORYJNYCH KATEDRA INŻYNIERII CHEMICZNEJ I PROCESOWEJ INSTRUKCJE ĆWICZEŃ LABORATORYJNYCH Operacje i techniki sorpcji desorpcji w układach cieczciało stałe / ciecz-ciecz w rozdzielaniu składników mieszanin / grup

Bardziej szczegółowo

ZASTOSOWANIE CHROMATOGRAFII CIECZOWEJ W BIOTECHNOLOGII ŚRODOWISKOWEJ

ZASTOSOWANIE CHROMATOGRAFII CIECZOWEJ W BIOTECHNOLOGII ŚRODOWISKOWEJ Wstęp: ZASTOSOWANIE CHROMATOGRAFII CIECZOWEJ W BIOTECHNOLOGII ŚRODOWISKOWEJ Chromatografią cieczową nazywamy chromatografię, w której eluentem jest ciecz, zwykle rozpuszczalnik organiczny. HPLC (ang. High

Bardziej szczegółowo

PAŃSTWOWA WYŻSZA SZKOŁA ZAWODOWA W PILE INSTYTUT POLITECHNICZNY. Zakład Budowy i Eksploatacji Maszyn PRACOWNIA TERMODYNAMIKI TECHNICZNEJ INSTRUKCJA

PAŃSTWOWA WYŻSZA SZKOŁA ZAWODOWA W PILE INSTYTUT POLITECHNICZNY. Zakład Budowy i Eksploatacji Maszyn PRACOWNIA TERMODYNAMIKI TECHNICZNEJ INSTRUKCJA PAŃSTWOWA WYŻSZA SZKOŁA ZAWODOWA W PILE INSTYTUT POLITECHNICZNY Zakład Budowy i Eksploatacji Maszyn PRACOWNIA TERMODYNAMIKI TECHNICZNEJ INSTRUKCJA Temat ćwiczenia: POMIAR CIŚNIENIA SPRĘŻANIA SILNIKA SPALINOWEGO.

Bardziej szczegółowo