Uniwersytet Warszawski Wydział Biologii

Wielkość: px
Rozpocząć pokaz od strony:

Download "Uniwersytet Warszawski Wydział Biologii"

Transkrypt

1 Uniwersytet Warszawski Wydział Biologii Olga Anna Krysiak Nr albumu: Analiza struktury i funkcji plazmidu pok1 wyizolowanego egzogennie z bakterii występujących w osadzie czynnym oczyszczalni ścieków Czajka Structure and functions of plasmid pok1 obtained by exogenous isolation from bacteria of activated sludge treatment plant Czajka Praca licencjacka na kierunku Biotechnologia w ramach Międzywydziałowych Indywidualnych Studiów Matematyczno - Przyrodniczych w zakresie Mikrobiologii Praca wykonana pod kierunkiem prof. dr hab. Dariusza Bartosika w Zakładzie Genetyki Bakterii Instytutu Mikrobiologii Wydziału Biologii Uniwersytetu Warszawskiego Warszawa, wrzesień 2013

2 Oświadczenie kierującego pracą Oświadczam, że niniejsza praca została przygotowana pod moim kierunkiem i stwierdzam, że spełnia ona warunki do przedstawienia jej w postępowaniu o nadanie tytułu zawodowego. Data Podpis kierującego pracą Oświadczenie autora pracy Świadom odpowiedzialności prawnej oświadczam, że niniejsza praca dyplomowa została napisana przez mnie samodzielnie i nie zawiera treści uzyskanych w sposób niezgodny z obowiązującymi przepisami. Oświadczam również, że przedstawiona praca nie była wcześniej przedmiotem procedur związanych z uzyskaniem tytułu zawodowego w wyższej uczelni. Oświadczam ponadto, że niniejsza wersja pracy jest identyczna z załączoną wersją elektroniczną. Data Podpis autora pracy 2

3 Streszczenie W niniejszej pracy zaprezentowano wyniki kompleksowej analizy bioinformatycznej sekwencji nukleotydowej plazmidu pok1 ( pz), wyizolowanego metodą egzogenną z bakterii osadu czynnego oczyszczalni ścieków Czajka w Warszawie. W plazmidzie pok1 wyodrębniono potencjalne moduły genetyczne: (i) systemy replikacyjne (REP), (ii) systemy odpowiedzialne za stabilne utrzymywanie plazmidu w komórce - system partycyjny (PAR) i addykcyjny (TA), (iii) potencjalny system mobilizacji do transferu koniugacyjnego (MOB), (iv) sekwencje insercyjne (IS) zintegrowane z genomem plazmidu oraz (v) determinanty oporności. Przeprowadzono również analizę funkcjonalną zidentyfikowanych systemów REP i MOB. Słowa kluczowe plazmid, analizy bioinformatyczne sekwencji nukleotydowej, antybiotykooporność, horyzontalny transfer genów Dziedzina pracy (kody wg programu Sokrates-Erasmus) 13.4 Biotechnologia 3

4 Serdecznie dziękuję Prof. dr hab. Dariuszowi Bartosikowi za pomoc w powstawianiu tej pracy, wsparcie merytoryczne i cenne wskazówki mgr. Marcinowi Adamczukowi za cenne wskazówki podczas tworzenia pracy Wszystkim Pracownikom, Koleżankom i Kolegom z Zakładu Genetyki Bakterii za stworzenie miłej atmosfery 4

5 Spis treści Wykaz skrótów stosowanych w pracy... 7 Wstęp Geny oporności w środowisku Rola oczyszczalni ścieków w generowaniu nowych oporności i ich transferze Izolacja i identyfikacja plazmidu pok Cel pracy Materiały Szczepy i plazmidy bakteryjne Podłoża Roztwory i bufory Roztwory do izolacji DNA metodą lizy alkalicznej: Bufory i roztwory stosowane do elektroforezy DNA: Roztwory do transformacji bakterii metodą rubidowo-wapniową: pozostałe bufory i roztwory: Enzymy, zestawy odczynników, wzorzec wielkości Odczynniki i ich pochodzenie Metody (opisane według skryptu ZGB) Analiza in silico sekwencji nukleotydowych i aminokwasowych Warunki hodowli Izolacja, obróbka i elektroforeza DNA Izolacja plazmidowego DNA w małej skali Izolacja i wizualizacja plazmidowego DNA poprzez ekstrakcję mieszanina fenol:chloroform Elektroforeza drobnocząsteczkowego DNA w żelu agarozowym Enzymatyczna obróbka DNA Wprowadzanie DNA do komórek bakteryjnych Transformacja komórek E. coli Koniugacja trójrodzicielska Wyniki i Dyskusja Odczytanie kompletnej sekwencji nukleotydowej plazmidu pok Analiza sekwencji nukleotydowej plazmidu pok Analiza systemów replikacyjnych

6 System REP System REP System REP Systemy odpowiedzialne za stabilne utrzymywanie plazmidu w komórce System partycyjny Systemy toksyna-antytoksyna System restrykcji-modyfikacji Analiza potencjalnego systemu mobilizacji do transferu koniugacyjnego Inne elementy genetyczne zintegrowane z genomem plazmidu Elementy transpozycyjne Integron Determinanty oporności Fosfotransferaza streptomycyny Syntaza dihydroptrynianowa Białka warunkujące odporność na tetracyklinę Reduktaza dihydrofolianowa, acetylotransferaza aminoglikozydowa, β- laktamaza, białko warunkujące oporność na czwartorzędowe związki amonowe Dodatkowy ładunek genetyczny plazmidu pok Transferaza adenozynofosforanu SoFic Białko z rodziny SNF Inwertaza DNA Resolwaza Hipotetyczne białka o nieznanej funkcji Analiza funkcjonalna wybranych modułów genetycznych plazmidu pok Moduł replikacyjny Analiza funkcjonalna systemów replikacyjnych Określenie zakresu gospodarzy systemów replikacyjnych pok Badanie mobilizacji plazmidu pok1 do transferu koniugacyjnego Wnioski Bibliografia

7 Wykaz skrótów stosowanych w pracy 1. Skróty nazw nukleotydów: A adenina C cytozyna G guanina T tymina N dowolny nukleotyd ATP adenozynotrifosforan camp cykliczny adenozynomonofosforan NADP fosforan dinukleotydu nikotynoamidoadeninowego 2. Skróty nazw aminokwasów: A alanina C cysteina D kwas asparaginowy E kwas glutaminowy F fenyloalanina G glicyna H histydyna I izoleucyna K lizyna L leucyna M metionina N asparagina P prolina Q - glutamina R arginina S - seryna T - treonina V - walina W - tryptofan Y - tyrozyna X dowolny aminokwas 3. Pozostałe skróty: aa aminokwas(y) (ang. amino acid(s)) CoA koenzym A (ang. coenzyme A) DNA kwas deoksyrybonukleinowy (ang. deoxyribonucleic acid) HGT horyzontalny transfer genów (ang. horizontal gene transfer) HTH motyw helisa skręt helisa (ang. helix turn helix) IGS region międzygenowy (ang. intergenic sequence) IR odwrócone powtórzenia sekwencji nukleotydowej (ang. inverted repeat) 7

8 IT iteron MGE ruchome elementy genetyczne (ang. mobile genetic element) NCBI National Center for Biotechnology Information nt nukleotyd(y) (ang. nucleotide(s)) ORF otwarta ramka odczytu (ang. open reading frame) oriv origin replikacji wegetatywnej P promotor Pd palindrom pz pary zasad rbs miejsce wiązania rybosomy (ang. ribosome binding site) REP moduł replikacyjny R-M system restrykcji modyfikacji (ang. restriction - modification) RNA kwas rybonukleinowy (ang. rybonucleic acid) TA system toksyna antytoksyna TE elementy transpozycyjnye (ang. transposable elements) ZGB Zakład Genetyki Bakterii 8

9 Wstęp 1. Geny oporności w środowisku Nasilające się w ostatnich latach zjawisko antybiotykooporności bakterii jest niepokojącym problemem. Niestety nie jesteśmy w stanie skutecznie przeciwdziałać powstawaniu coraz większej liczby szczepów opornych. Dostępne dane wskazują, że w ponad 600 genomach bakterii opornych na antybiotyki występuje ponad 1300 genów oporności (Liu i Pop, 2009), które mogą być przenoszone miedzy bakteriami w wyniku horyzontalnego transferu genów (HGT, ang. horizontal gene transfer). Niekontrolowane stosowanie antybiotyków powoduje selekcję opornych szczepów bakterii, które zaczynają dominować w różnych populacjach. Izolowane są często szczepy wielooporne, wykazujące oporność na kilka różnych antybiotyków/chemioterapeutyków, np. szczepy gronkowca złocistego, Staphylococcus aureus, niewrażliwe na metycylinę i wykazujące mniejszą wrażliwość na antybiotyki glikopeptydowe oraz wankomycynę (MRSA) (Witte, 1999). Oporność jest często wynikiem zmniejszenia stopnia akumulacji szkodliwej substancji we wnętrzu komórki, co jest spowodowane obecnością pomp błonowych, zwykle charakteryzujących się szerokim spektrum substratowym (Poole, 2002). Oporność krzyżową, wynikającą z obecności takich pomp, wykazują między innymi szczepy Pseudomonas stutzeri, Pseudomonas areuginosa oraz mutanty mar Escherichia coli (Muñoz Bellido i wsp., 2002). Należy zaznaczyć, że sprawcami groźnych infekcji stają się ostatnio nie tylko bakterie uznawane od dawna za patogenne, lecz również szczepy oportunistyczne, do których zalicza się m.in. bakterie z rodzajów Klebsiella, Serratia, Proteus i Pseudomonas (Vetter i Haver, 2002). Często postrzegamy oporność w sposób uproszczony, tj. przyjmujemy, że szczep bakterii jest oporny lub wrażliwy. Problematyczne jest jednak określenie progu pozwalającego na zdefiniowanie rzeczywistej oporności. Często wzrost bakterii w obecności niewielkiej ilości antybiotyku jest bagatelizowany, choć wiadomo, że poszczególne mechanizmy mogą warunkować oporność na różnym poziomie. Nawet taka "szczątkowa" oporność może pełnić ważną rolę w selekcji opornych szczepów w środowisku naturalnym. Najpowszechniejszą odpowiedzią komórki na antybiotyk jest zahamowanie wzrostu, czyli bakteriostaza. W leczeniu infekcji, efekt bakteriostatyczny jest często efektywny, 9

10 ponieważ patogeny są zabijane i usuwane z organizmu przez układ odpornościowy gospodarza. Odmienną sytuację obserwujemy w środowisku, gdzie przenoszenie genów oporności oraz rozprzestrzenianie się opornych szczepów jest stymulowane długotrwałą obecnością antybiotyku w subterapeutycznym stężeniu (Kümmerer, 2004). Za główną przyczynę wzrostu oporności uważa się nadmierne i nieuzasadnione stosowanie antybiotyków (Séveno i wsp., 2002). Związki te są wykorzystywane nie tylko w celach leczniczych (w medycynie i weterynarii), lecz również stosowane są jako substancje przyspieszające wzrost zwierząt hodowlanych, a także jako związki antybakteryjne przy produkcji środków czyszczących i dezynfekujących. Niektóre z antybiotyków stosowanych w medycynie, np. amoksycylina i erytromycyna, są również stosowane jako promotory wzrostu zwierząt (Sarmah i wsp., 2006). Związki te nie są całkowicie metabolizowane i trafiają do środowiska, co stwarza warunki presji selekcyjnej (Al-ahmad i wsp., 1999). Sugeruje się, że rozprzestrzenianiu szczepów opornych sprzyja także stosowanie szczepionek i biocydów. Na przykład, skorelowano zastosowania szczepionki przeciwko Streptococcus pneumoniae ze wzrostem liczby infekcji spowodowanych przez oporne szczepy S. aureus, jednak podstawy tego zjawiska nie zostały szczegółowo zbadane (A report from the American Society of Microbiology, 2009). Zakłada się również, że biocydy, dodawane w stężeniach subletalnych do stosowanych powszechnie środków czystości, prowadzą do selekcji wielu szczepów opornych. Podobną rolę przypisuje się niektórym związkom chemicznym, m.in. związkom rtęci i srebra (obecnym np. w wypełnieniach stomatologicznych), chininie, lekom przeciwwirusowym oraz niektórym mikroelementom (np. cynk, arsen i miedź). Pomimo wielu dowodów potwierdzających rolę presji antropogenicznej w generowaniu fenotypów opornościowych, badania z ostatnich lat wskazują, że oporność nie jest zjawiskiem nowym, istniała bowiem na długo przed odkryciem antybiotyków. Analizy metagenomiczne starożytnego DNA, pochodzącego z osadów wiecznej zmarzliny datowanych na lat, pozwoliły na identyfikację genów oporności na β-laktamy, tetracyklinę oraz antybiotyki glikopeptydowe. Stwierdzono ponadto, że kompletny wariant genu vana, warunkującego oporność na wankomycynę, jest podobny do współczesnego, co dodatkowo potwierdza, że używanie antybiotyków jedynie zwiększa presję selekcyjną szczepów opornych, lecz nie było czynnikiem indukującym powstania oporności (D costa i wsp., 2011). Środowisko naturalne jest ogromnym rezerwuarem genów oporności, których źródłem może być większość bakterii. Geny tego typu często pochodzą ze szczepów produkujących 10

11 antybiotyki, gdzie chronią komórki gospodarza przed szkodliwym działaniem wytwarzanych przez nie związków. Oporność często związana jest z obecnością wspomnianych wcześniej pomp usuwających niepożądane substancje z komórki. Pompy tego typu kodowane są nie tylko przez szczepy produkujące antybiotyki. Prawdopodobnie pełnią one również ważne funkcje m.in. w usuwaniu metabolitów pośrednich, wirulencji, czy sygnalizacji międzykomórkowej (Piddock, 2006). Geny oporności mogą też wywodzić się od genów zaangażowanych w metabolizm bakterii. Na przykład enzym β-laktamaza, warunkujący oporność na antybiotyki - laktamowe, należy do grupy białek wiążących penicylinę, z których wiele pełni ważne funkcje w metabolizmie mureiny. Głównym zjawiskiem umożliwiającym nabywanie przez bakterie oporności jest horyzontalny transfer genów, warunkujący przenoszenie informacji genetycznej między komórkami bakterii. Transfer ten w obecności antybiotyków może być zintensyfikowany, np. w wyniku indukcji ekspresji genów systemów koniugacyjnych niektórych typów ruchomych elementów genetycznych. W wyniku HGT do bakterii mogą być wprowadzone duże segmenty DNA, niosące niekiedy kilka genów opornościowych, co skutkuje powstaniem szczepów wieloopornych. Geny oporności są znajdowane zarówno w plazmidach jak i chromosomach. Duża ich liczba występuje w obrębie integronów, które stanowią naturalne systemy umożliwiające konwersję wyciszonych kaset genowych do funkcjonalnych genów. Nabycie fenotypu oporności w wyniku HGT stanowi istotną korzyść w naturalnej konkurencji między mikroorganizmami i niewątpliwie prowadzi do wzrostu liczebności populacji opornych szczepów bakterii patogennych. 2. Rola oczyszczalni ścieków w generowaniu nowych oporności i ich transferze Głównym celem oczyszczalni ścieków jest usuwanie z nich toksycznych substancji organicznych i nieorganicznych, zmniejszenie w nich stężenia organicznego węgla, azotu i fosforu oraz eliminacja różnego typu organizmów patogennych. W tym celu wykorzystywane są procesy fizyczne (np. filtracja), chemiczne (np. dezynfekcja), jak i procesy przeprowadzane przez niektóre mikroorganizmy. Osady czynne i biofilmy znajdowane w oczyszczalniach są bogate w substancje odżywcze, co stwarza idealne środowisko bytowania dla bakterii (Dionisio i wsp., 2002; Sorensen i wsp,. 2005). Dzięki temu różnorodność występujących tam mikroorganizmów jest 11

12 bardzo duża. Analizy metagenomowego DNA wyizolowanego z prób pochodzących z oczyszczalni ścieków (amplifikacja PCR oraz sekwencjonowanie genów 16S rrna) pozwoliły zidentyfikować przedstawicieli ponad dwadziestu gromad bakterii. Najliczniejsze grupy stanowiły: Proteobacteria, Chloroflexi, Firmicutes, Spirochaetes i Bacteroides (Wagner i Loy, 2002), a więc zarówno bakterie gramdodatnie jak i gramujemne, w tym ważne pod względem klinicznym patogeny oportunistyczne. Tak duże nagromadzenie bakterii stwarza doskonałe warunki stymulujące zdarzenia HGT, które zwykle prowadzą do naturalnej amplifikacji genów oporności i rozpowszechnienia fenotypów opornościowych. Tym bardziej, że w izolatach pochodzących z oczyszczalni ścieków identyfikowane są szczepy oporne na wszystkie ważne, z klinicznego punktu widzenia, klasy antybiotyków, takie jak: makrolidy, tetracykliny, cefalosporyny, fluorochinolony, aminoglikozydy i β-laktamy (Bennett, 2008; Martinem, 2009; Szczepanowski i wsp., 2009). Powszechnie wiadomo, że głównymi sprawcami HGT są ruchome elementy genetyczne (MGE, mobile genetic elements). Rezerwuar MGE identyfikowanych w bakteriach z oczyszczalni ścieków jest bogaty i bardzo różnorodny. Wykryto np. liczne elementy transpozycyjne (transpozony i sekwencje insercyjne), elementy koniugacyjne i integrujące z DNA oraz integrony (Bennett, 2008; Slater i wsp. 2008). Elementy te znajdowane są (w różnych kombinacjach) w genomach licznych plazmidów koniugacyjnych, co stymuluje ich transfer do innych gospodarzy. Elementy transpozycyjne kodują transpozazę, enzym katalizujący proces transpozycji. Są one bardzo zróżnicowane pod względem struktury genetycznej. Jedną z najliczniejszych grup transpozonów stanowi rodzina Tn21. Transpozony z tej grupy często występują w obrębie integronów, które uważane są za jeden z głównych czynników determinujących wielooporność u bakterii. Badania sugerują, że plazmidy nabywają mobilne elementy w wyniku różnorodnych procesów rekombinacyjnych. Liczne plazmidy opornościowe wyizolowane z izolatów z oczyszczalni ścieków niosą integrony klasy pierwszej, często sprzężone z transpozonem z rodziny Tn402 (Schluter i wsp., 2007). Integrony te mogą zawierać do sześciu różnych determinant opornościowych, w tym warunkujących oporność na czwartorzędowe związki amoniowe. W genomach plazmidów spotyka się również geny oporności na inne związki toksyczne, np. jony metali ciężkich i ksenobiotyki, co wskazuje na ich wzmożoną presję selekcyjną w środowisku oczyszczalni. Oczyszczalnie to zatem miejsce ważne z punktu widzenia ewolucji plazmidów, bowiem w środowisku tym dochodzi do częstego transferu tych replikonów oraz nabywania przez nie nowych modułów genetycznych. 12

13 Prowadzone dotąd badania potwierdzają, że bakterie niosące plazmidy opornościowe nie są eliminowane w trakcie procesu oczyszczania ścieków. W bakteriach tych dominują plazmidy o szerokim spektrum gospodarzy. Przeprowadzona identyfikacja i analiza genomów 140 plazmidów niosących geny oporności na antybiotyki o znaczeniu klinicznym, ilustruje mozaikową strukturę tych replikonów (Szczepanowski i wsp., 2009). Niektóre z tych plazmidów były izolowane z końcowego wycieku z oczyszczalni, wprowadzanego bezpośrednio do środowiska. Najliczniejszą grupą stanowią plazmidy należące do grupy niezgodności IncP-1. Pokrewne plazmidy izolowane są również ze środowisk naturalnych (Bahl i wsp., 2009). Plazmidy z grupy IncP-1 nie tylko mogą się replikować w szerokim spektrum gospodarzy, lecz mogą też mobilizować do transferu koniugacyjnego inne plazmidy. Transfer ten może zachodzić również do bakterii gramdodatnich (Mazodier i wsp., 1989), cyjanobakterii (Kreps i wsp., 1990) oraz do drożdży (Heinemann i Sprague, 1989). Odcieki z oczyszczalni są zwykle uwalniane do rzek, dzięki czemu przedostają się do innych zbiorników wodnych, takich jak jeziora czy wody przybrzeżne (Zang i wsp., 2009). Ponadto, osady czynne wykorzystywane są w rolnictwie do nawożenia pól (Chee-Sanford i wsp., 2009), co dodatkowo przyczynia się do wzrostu liczby szczepów opornych w środowisku. Rozpowszechnienie plazmidów opornościowych wśród mikroorganizmów środowiskowych zależy głównie od możliwości stabilnego utrzymywania tych replikonów w komórkach gospodarzy. Jak wspomniano, plazmidy często warunkują liczne, różnorodne cechy fenotypowe. Dzięki temu plazmidy niosące geny oporności na antybiotyki mogą być przenoszone i stabilnie dziedziczone nawet w środowiskach nie poddawanych działaniu presji selekcyjnej antybiotyku (Sorensen i wsp., 2005; Allen i wsp., 2010). Szczególnie niebezpieczne, z punktu widzenia człowieka, jest przekazywanie tych plazmidów bakteriom patogennym, co utrudnia bądź uniemożliwia ich skuteczną eliminację (D costa i wsp,. 2006). 3. Izolacja i identyfikacja plazmidu pok1 W Zakładzie Genetyki Bakterii (ZGB) Wydziału Biologii UW prowadzone są badania mające na celu identyfikację ruchomych elementów genetycznych niosących determinanty oporności na antybiotyki. Jednym z analizowanych środowisk jest oczyszczalnia ścieków Czajka w Warszawie. Z mieszaniny bakterii występujących w osadzie czynnym tej oczyszczalni wyizolowano, metodą egzogenną, plazmid pok1, o szacowanej wielkości ok. 40 kpz. Egzogenna izolacja plazmidów polega na wyodrębnieniu replikonu poprzez transformację 13

14 metagenomowego DNA do zdefiniowanego biorcy (w tym przypadku E. coli TG1) z zastosowaniem odpowiedniej selekcji. Plazmid zdefiniowano pierwotnie jako replikon warunkujący oporność na kanamycynę. Odczytano kompletną sekwencję nukleotydową pok1. W niniejszej pracy przeprowadzono analizę bioinformatyczną uzyskanej sekwencji oraz analizę funkcjonalną jego wybranych modułów genetycznych. 14

15 Cel pracy Celem niniejszej pracy było przeprowadzenie kompleksowej analizy bioinformatycznej sekwencji nukleotydowej plazmidu pok1, wyizolowanego egzogennie z bakterii występujących w osadzie czynnym oczyszczalni ścieków Czajka w Warszawie oraz przeprowadzenie analiz funkcjonalnych wybranych modułów genetycznych tego replikonu. 15

16 Materiały 1. Szczepy i plazmidy bakteryjne Szczepy i plazmidy bakteryjne, które wykorzystano i skonstruowano w tej pracy przedstawiono w tabelach 1 i 2. Tab. 1. Szczepy bakteryjne wykorzystywane w pracy. Nazwa Charakterystyka Pochodzenie E. coli TG1 F ;(trad36 proab + laci q laczδm15) supe44 hsdδ5 Δ(lac - proab.); szczep wykorzystywany do transformacji E. coli DH5α F - ; Φ80D laczδm15 (laczyaorgf)u169 deor reca1 enda1 hsdr17 phoa supe44 λ - thi1 gyra96 rela1 Gibson, 1984 Sambrook i Russell, 2001 Szczepy wykorzystywane w badaniu zakresu gospodarza wektorów wahadłowych niosących systemy replikacyjne plazmidu pok1: Paracoccus aminovorans JCM7685R Agrobacterium tumefaciens LBA 288R Alcaligenes sp. LM16R Stenotrophomonas sp. LM24R Pseudomonas sp. LM12R Vogesella sp. 93R Rif r ; pochodna dzikiego szczepu JCM7685R Rif r ; pochodna dzikiego szczepu LBA 288R Rif r ; pochodna dzikiego szczepu LM16R Rif r ; pochodna dzikiego szczepu LM24R Rif r ; pochodna dzikiego szczepu LM12R Rif r ; pochodna dzikiego szczepu 93R ZGB ZGB ZGB ZGB ZGB ZGB Klebsiella pneumoniae Rif r ; pochodna dzikiego szczepu ZGB Yersinia enterocoltica Ye0:9R Aeromonas sp. 82R Rif r ; pochodna dzikiego szczepu Ye0:9R Rif r ; pochodna dzikiego szczepu 82R ZGB ZGB 16

17 Tab. 2. Plazmidy bakteryjne wykorzystane w pracy. Nazwa Charakterystyka Pochodzenie pok1 naturalny plazmid wyizolowany z osadu czynnego oczyszczalni ścieków ZGB prk2013 Km r ; 4,8 kpz; oricole1; Tra + (system transferu RK2); plazmid pomocniczy w koniugacji trójrodzicielskiej pabw1 Km r ; 4,5 kpz ori pmb1; Mob + ; orit RK2; laczα; MCS Ditta i wsp., 1980 Bartosik i wsp., 1997 pok1a pok1b Km r ; kpz; pochodna plazmidu pabw1 zawierająca, wklonowany w miejsce SacI, EcoRI fragment restrykcyjny SacI, EcoRI plazmidu pok1 (9,4 kpz; pozycja sekwencji pok1), zawierający m. in. system replikacyjny REP2 pok1 Km r ; kpz; pochodna plazmidu pabw1 zawierająca, wklonowany w miejsce SacI, KpnI, fragment restrykcyjny SacI, KpnI plazmidu pok1 (13,8 kpz; pozycja sekwencji pok1), zawierający m. in. systemy replikacyjne REP1 i REP3 pok1 ta praca ta praca 2. Podłoża W pracy stosowano podłoże LB (Luria-Bertani): trypton 10g/l, ekstrakt drożdżowy 5 g/l, NaCl 5 g/l; ph 7,0 (Sambrook i Russel, 2001). Podłoże stałe (LA) otrzymywano poprzez zestalenie podłoża płynnego agarem 15g/l. W zależności od potrzeb eksperymentu podłoża uzupełniano: - mieszaniną X gal (5-bromo-4-chloro-3-indolilo-β-D-galaktopiranozyd) i IPTG (izopropylo β-d-1-thiogalaktopiranozyd) - roztworami antybiotyków w stężeniach dobranych eksperymentalnie, w zależności od doświadczenia: - kanamycyna 50, 100, 300, 400, 500, 1000 μg/ml; 17

18 - trimetoprim 50, 100 μg/ml; - tetracyklina 10, 20 μg/ml; - streptomycyna 50 μg/ml; - ryfampicyna 50 μg/ml. 3. Roztwory i bufory 3.1. Roztwory do izolacji DNA metodą lizy alkalicznej: - roztwór I: 50 mm glukoza, 25 mm Tris-HCl, 10 mm EDTA; ph 8,0; - roztwór II: 0,2 M NaOh, 1% SDS; - roztwór III: 3 M octan potasu, 5 M kwas octowy; ph 4, Bufory i roztwory stosowane do elektroforezy DNA: - bufor TAE: 40 mm Tris base, 20 mm kwas octowy, 1mM EDTA; - bufor obciążający: 0,25% błękit bromofenolowy, 30% glicerol; - żel agarozowy: 0,8% agaroza w buforze TAE Roztwory do transformacji bakterii metodą rubidowo-wapniową: - roztwór I: 10 mm MOPS, 10 mm RbCl 2 ; ph 7,0; -roztwór II: 100 mm MOPS, 50 mm CaCl 2, 10 mm RbCl 2 ; ph 6, pozostałe bufory i roztwory: - bufor TE: 10 mm Tris-HCl, 1mM EDTA; ph 8,0; - mieszanina stosowana do odbiałczania preparatów DNA: fenol nasycony 1 M Tris-HCl (ph 8,0) : chloroform 1:1 (v/v); - roztwór fizjologiczny (RF): 0,85% NaCl. 4. Enzymy, zestawy odczynników, wzorzec wielkości - enzymy restrykcyjne, ligaza DNA faga T4 Fermentas, RNaza Roche, do obróbki enzymatycznej używano buforów dostarczonych przez producentów; - zestawy odczynników: Plazmid Miniprep Plus, DNA Clean Up A&A Biotechnology; 18

19 - wzorzec wielkości liniowych fragmentów DNA: a KB Plus DNA Lauder (wielkości fragmentów: 12,0; 11,0; 10,0; 9,0; 8,0; 7,0; 6,0; 5,0; 4,0; 3,0; 2,0; 1,65; 1,0; 0,85; 0,65; 0,5; 0,4; 0,3; 0,2; 0,1 kpz) Invitrogen. 5. Odczynniki i ich pochodzenie - BIO 101: tetracyklina; - BIOCORP: LB; - MERC: agar-agar; - POCh: aceton, błękit bromofenolowy, chloroform, kwas octowy, metanol, glicerol; - PRONA: agaroza; - SIGMA: 5-bromo-4-chloro-3-indolilo-β-D-galaktopiranozyd (X gal), bromek etydyny, chlorek rubidu, chlorek sodu, chlorek wapnia, dimetylosulfotlenek (DMSO), N,Ndimetyloformamid (DMF), dodecylosiarczan sodowy (SDS), fenol, glukoza, izopropylo β-d- 1-thiogalaktopiranozyd (IPTG), kanamycyna, kwas 3-(N-morfolino)propanosulfonowy (MOPS), kwas solny, octan potasu, octan sodu, ryfampicyna, streptomycyna, trimetoprim, Tris Base, uwodniony wersenian dwusodowy (EDTA), wodorotlenek sodowy. Metody (opisane według skryptu ZGB) 1. Analiza in silico sekwencji nukleotydowych i aminokwasowych W tabeli 3 przedstawiono narzędzia wykorzystywane do przeprowadzenia analiz bioinformatycznych. Tab. 3. Narzędzia bioinformatyczne. Narzędzie Zastosowanie Dostęp Artemis adnotacja sekwencji, wyróżnienie ORF, wyznaczanie zawartości par G+C w sekwencji ources/software/artemis/ nukleotydowej, translacja in silico, przewidywanie wielkości i masy cząsteczkowej białek Clone Manager versja 8 adnotacja sekwencji, wyróżnienie ORF, identyfikacja miejsc rozpoznawanych przez enzymy restrykcyjne, identyfikacja sekwencji powtórzonych i palindromowych, wizualizacja map genetycznych plazmidów, planowanie klonowania in silico Scientific & Educational Software 19

20 Narzędzie Zastosowanie Dostęp Programy BLAST BPROM porównywanie sekwencji nukleotydowych i aminokwasowych z sekwencjami zdeponowanymi w bazach danych identyfikacja potencjalnych sekwencji promotorowych erry.phtml?topic=bprom&g roup=programs&subgroup =gfindb ORF Finder wyróżnienie ORF /projects/gorf/ GYM 2.0 Helix Turn Helix Motif Prediction ISfinder T-Coffee Motif Scan Pfam NCBI Conserved Domain Serach InterProScan BoxShade NCBI Predict Protein YASPIN Reverse Complement identyfikacja potencjalnych motywów helisa skręt helisa w sekwencjach aminokwasowych identyfikacja sekwencji podobnych do sekwencji elementów transpozycyjnych przyrównanie sekwencji nukleotydowych i aminokwasowych identyfikacja konserwowanych domen i motywów w sekwencjach białek wizualizacja przyrównań sekwencji nukleotydowych i aminokwasowych dostęp do baz danych GenBank, InterPro, PubMed i in. przewidywanie struktury drugorzędowej białek konwersja sekwencji nukleotydowych na sekwencje odwrócone i/lub komplementarne bioinf/gym2/welcome.html /NPSA/npsa_hth.html https://www-is.biotoul.fr// msa/tcoffee/ /Structure/cdd/wrpsb.cgi pfa/iprscan/ oftware/box_form.html / https://www.predictprotein. org/ ms/yaspinwww/ rg/sms/rev_comp.htm 20

21 Narzędzie Zastosowanie Dostęp REBASE źródło danych dotyczących systemów restrykcji - modyfikacji /rebase.html 2. Warunki hodowli Szczepy bakteryjne namnażano w podłożu LB z wytrząsaniem przez noc lub do osiągnięcia fazy wzrostu wykładniczego w łaźni powietrznej w temperaturze 37 o C (Escherichia coli) lub 30 o C (pozostałe szczepy). Na podłożu stałym (LA) prowadzono inkubację w identycznych warunkach temperatury przez 24 godziny lub dłużej w zależności od potrzeb eksperymentu. 3. Izolacja, obróbka i elektroforeza DNA 3.1. Izolacja plazmidowego DNA w małej skali Plazmidowy DNA izolowano według zmodyfikowanej metody Birnboima i Doly ego (1979). 1,5 ml nocnej hodowli bakteryjnej wirowano przez czas 3 min w temperaturze pokojowej w mikrowirówce MPW52 ( rpm). Otrzymany osad zawieszano w 100 μl schłodzonego roztworu I. Po 5-minutowej inkubacji w temperaturze pokojowej dodawano 200 μl roztworu II, delikatnie mieszano i inkubowano w lodzie przez 5 min. Następnie dodawano 150 μl schłodzonego roztworu III i ponownie inkubowano w lodzie przez 5 min. Po inkubacji dodawano 30 μl mieszaniny fenol:chloroform. Po dokładnym wymieszaniu lizat wirowano 10 min w mikrowirówce ( rpm), a do zebranego supernatantu dodawano 1 ml 96% alkoholu etylowego. DNA wytracano przez 20 min w temperaturze -20 o C. Następnie próbki wirowano przez 10 min ( rpm) w temperaturze 4 o C, a otrzymany osad przemywano 70% etanolem, suszono i zawieszano w μl buforu TE. Do izolacji paliamidowego DNA z komórek E. coli i szczepów środowiskowych wykorzystywano także zestaw Plasmid Miniprep Plus firmy A&A Biotechnology, zgodnie z instrukcją załączoną przez producenta. 21

22 3.2. Izolacja i wizualizacja plazmidowego DNA poprzez ekstrakcję mieszanina fenol:chloroform Materiał poprany bezpośrednio z szalki zawieszano w 100 μl wody dejonizowanej, po czym dodawano równą objętość mieszaniny fenol:chloroform. Następnie intensywnie mieszano przy użyciu mikrowytrząsarki i wirowano 10 min ( rpm) w temperaturze pokojowej. 15 μl fazy wodnej mieszano z buforem obciążającym i nanoszono na żel agarozowy Elektroforeza drobnocząsteczkowego DNA w żelu agarozowym Elektroforezę DNA prowadzono w żelu agarozowym o stężeniu 0,8% w buforze TAE przy gradiencie napięć 3-5 V/cm, przez 1-1,5 godz. w temp. pokojowej. Po rozdziale elektroforetycznym żele umieszczano w wodnym roztworze bromku etydyny o końcowym stężeniu 0,5 μg/ml (10 min), a następnie płukano w wodzie destylowanej (10 min). Wyniki rozdziału analizowano w systemie ImageQuant 300, firmy GE Healthcare Enzymatyczna obróbka DNA Trawienie enzymami restrykcyjnymi prowadzono w warunkach zalecanych przez producenta, od 10 min do 1 godz., używając 2 jednostek enzymu na około 1 μg DNA. Jednoczesne trawienie dwoma enzymami prowadzono, jeśli było to możliwe, w buforze, w którym oba enzymy wykazywały nie mniej niż 50% aktywności w stosunku do warunków optymalnych. Ligację fragmentów DNA otrzymanych w wyniku wcześniejszego trawienia enzymami restrykcyjnymi z wektorami do klonowania prowadzono przez 12 godz. w temp. 16 o C. Używano 1-2 jednostki ligazy w mieszaninie reakcyjnej o końcowej objętości 20 μl, przy nadmiarze wstawki. DNA po obróbce enzymatycznej oczyszczano za pomocą zestawu DNA Clean Up firmy A&A Biotechnology, stosując zalecenia producenta. 4. Wprowadzanie DNA do komórek bakteryjnych 4.1. Transformacja komórek E. coli Komórki E. coli transformowano z wykorzystaniem zmodyfikowanej metody rubidowo wapniowej Kushnera (1978). Nocną hodowlę E. coli szczepiono w stosunku 1:50 do nowej 22

23 porcji pożywki i hodowano z intensywnym wytrząsaniem do uzyskania OD 600 0,4-0,5. Hodowlę, w porcjach po 1,5 ml, schładzano przez 5 min w lodzie i wirowano przez 3 min w 4 o C (6 000 rpm). Osad zawieszano w 1 ml roztworu I do transformacji, inkubowano w lodzie przez okres 10 min i ponownie wirowano jw. Po usunięciu supernatantu osad zawieszano w 200 μl roztworu II. Zawiesinę inkubowano 15 min w lodzie, po czym dodawano plazmidowy DNA i nadal inkubowano w takich samych warunkach. Po 10 min komórki poddawano szokowi cieplnemu w 43 o C przez 50s, a następnie dodawano 1 ml LB o temperaturze pokojowej. Przed wysiewem na odpowiednie podłoża selekcyjne bakterie inkubowano przez 1 godz. w temp. 37 o C Koniugacja trójrodzicielska W celu wprowadzenia odpowiednich plazmidów wykorzystano metodę koniugacji trójrodzicielskiej. Nocne hodowle szczepu dawcy (szczep E. coli TG1, zawierający odpowiedni plazmid), szczepu biorcy (badane szczepy Rif r ) oraz szczepu pomocniczego (E. coli DH5α z plazmidem prk2013 Km r, Tra + ), wirowano w celu usunięcia presji antybiotykowej, a następnie otrzymany osad zawieszano w świeżej porcji podłoża. Przygotowane hodowle dawcy, biorcy i szczepu pomocniczego mieszano w stosunku 1:2:1. Po 24 godzinnej inkubacji w 30 o C wyrosła murawę bakteryjną zmywano z powierzchni szalki 2 ml LB, a odpowiednie rozcieńczenia wysiewano na podłoże selekcyjne LA uzupełnione ryfampicyną oraz innym antybiotykiem/antybiotykami w odpowiednim stężeniu dobranym eksperymentalnie w zależności od szczepu. 23

24 Wyniki i Dyskusja 1. Odczytanie kompletnej sekwencji nukleotydowej plazmidu pok1 Wyizolowany DNA plazmidu pok1 został poddany sekwencjonowaniu. Wykorzystano technikę pirosekwencjonowania, która oparta jest na wykrywaniu pirofosforanu, uwalnianego podczas syntezy DNA. Ponieważ w wyniku sekwencjonowania uzyskano kilka kontigów sekwencji, konieczne było ich złożenie i ustalenie kompletnej mapy fizycznej replikonu. Ten etap badań został przeprowadzony przez Marcina Adamczuka - doktoranta Zakładu Genetyki Bakterii. 2. Analiza sekwencji nukleotydowej plazmidu pok1 Odczytano kompletną sekwencję nukleotydową plazmidu pok1, o wielkości pz. Procentowa zawartość par G+C sekwencji wynosi 38,74%. Analizę bioinformatyczną sekwencji rozpoczęto od wyznaczenia otwartych ramek odczytu (ORF, ang. open reading frame), kodujących potencjalne produkty białkowe. W tym celu wykorzystano programy Artemis i ORF Finder oraz wyniki analiz porównawczych, uzyskanych przy użyciu pakietu BLAST (NCBI). Wyróżniano ORF kodujące produkty białkowe o długości większej niż 50 aminokwasów (aa) lub mniejszej, w przypadku, gdy kodowane przez nie białka wykazywały istotne podobieństwo do sekwencji zdeponowanych w bazach danych. W rezultacie zidentyfikowano 49 ORF (Fig. 1), które zostały oznaczone, odpowiednio, jako orf01, orf02 itd., do orf49. Ich potencjalne produkty białkowe oznaczono jako Orf01, Orf02 itd. Jako pierwszy nukleotyd sekwencji została wybrana adenina występująca 539 nukleotydów powyżej kodonu START orf01. 24

25 Fig. 1. Organizacja genetyczna plazmidu pok1 ( pz). W górnym panelu przedstawiono profil zawartości par G+C (Artemis, okno 120 nt). Barwnymi ramkami wyróżniono podstawowe moduły genetyczne: na zielono moduły odpowiedzialne za replikację plazmidu, na pomarańczowo systemy odpowiedzialne za stabilne utrzymywanie plazmidu w komórce (PAR systemy partycyjne, RM restrykcji-modyfikacji oraz TA toksyna-antytoksyna), na niebiesko sekwencje insercyjne (IS) zintegrowane z genomem plazmidu, na fioletowo determinanty oporności (orf26 - prawdopodobnie warunkuje oporność na streptomycynę, orf27 na sulfonamidy, orf39 na trimetoprim, orf40 na aminoglikozydy, orf41 na β-laktamy, orf42 na czwartorzędowe związki amoniowe, orf44-45 na tetracyklinę). Ramką zaznaczono integron. W dolnym panelu zaznaczono za pomocą strzałek zasięg i orientację transkrypcyjną wyznaczonych ORF. Podstawowe informacje o wyznaczonych otwartych ramkach odczytu, tj. lokalizację, orientacje transkrypcyjną, wielkość potencjalnych produktów białkowych oraz ich prawdopodobna funkcję wraz z informacjami o ich najbliższych homologach zamieszczono w tabeli 4. Wyznaczone sekwencje kodujące stanowią 75,82% genomu plazmidu. Dzięki przeprowadzonym analizom porównawczym zidentyfikowanych ORF możliwe było wyróżnienie w obrębie sekwencji plazmidu pok1 kilku potencjalnych modułów genetycznych. Są to: (i) systemy replikacyjne (REP), (ii-iii) moduły odpowiedzialne za stabilne utrzymywanie plazmidu w komórce - system partycyjny (PAR) i addykcyjny (TA), (iv) potencjalny system mobilizacji do transferu koniugacyjnego (MOB), (v) sekwencje insercyjne (IS) zintegrowane z genomem plazmidu oraz (vi) determinanty oporności. Ważną informacją jest fakt, że 21 z potencjalnych produktów białkowych kodowanych w sekwencji pok1 wykazuje znaczny poziom (niekiedy 100%) identyczności z sekwencjami białek kodowanych w genomie Wohlfahrtiimonas chitiniclastica SH04 (Tabela 4). Pięć z nich 25

26 zostało opisanych jako potencjalne białka o nieznanej funkcji, nie wykazujące podobieństwa do innych białek zdeponowanych w bazach danych. Pozostałe to, między innymi: (i) białko inicjujące replikację (orf46), (ii) systemy toksyna-antytoksyna (orf14-15, orf20, orf23, orf47-48) oraz (iii) transpozazy orf19, orf22, orf43, orf49). Należy pokreślić, że niektóre geny są powielone w genomie pok1, np. geny systemu TA ( orf20-orf 23 i orf47-orf48) oraz gen transpozazy (orf49 i orf43). 26

27 Tabela 4. Otwarte ramki odczytu zidentyfikowane w plazmidzie pok1. ORF Region kodujący (pz) * Orientacja Wielkość białka (aa) Prawdopodobna funkcja hipotetyczne białko o nieznanej funkcji białko replikacyjne transferaza adenozynomonofosforanu SoFic Procent identyczności (aminkwasy ) 100 (193/193 Największe podobieństwo (program BLASTP) Organizm Wohlfahrtiimonas chitiniclastica SH04 Numer w GenBank ZP_ (134/242) Acinetobacter lwoffii SH145 ZP_ (344/358) Wohlfahrtiimonas chitiniclastica SH04 ZP_ białko z rodziny SNF2 74 (706/949) Acinetobacter baumannii WC-136 ZP_ metylotransferaza DNA 58 (617/1071) Acinetobacter sp. HA ZP_ potencjalny enzym restrykcyjny, N- końcowa część potencjalny enzym restrykcyjny, C- końcowa część hipotetyczne białko o nieznanej funkcji 99 (88/89) hipotetyczne białko o 99 (169/171) nieznanej funkcji inwertaza DNA 99 (199/200) inhibitor inicjacji sporulacji Soj, częściowy 53 (427/802) Escherichia coli DEC1C EHU (153/348) Escherichia coli DEC2A ZP_ (183/184) Wohlfahrtiimonas chitiniclastica SH04 Wohlfahrtiimonas chitiniclastica SH04 Wohlfahrtiimonas chitiniclastica SH04 Wohlfahrtiimonas chitiniclastica SH04 ZP_ ZP_ ZP_ ZP_

28 ORF Region kodujący (pz) * Orientacja Wielkość białka (aa) Prawdopodobna funkcja Procent identyczności (aminkwasy ) Największe podobieństwo (program BLASTP) Organizm Numer w GenBank białko partycyjne ParB Xanthomonas arboricola pv. pruni str (33/62) CFBP 5530 YP_ hipotetyczne białko o Wohlfahrtiimonas chitiniclastica 98 (97/990) nieznanej funkcji SH04 ZP_ toksyna YoeB Wohlfahrtiimonas chitiniclastica 100 (87/87) SH04 ZP_ antytoksyna YefM Wohlfahrtiimonas chitiniclastica 100 (85/85) SH04 ZP_ inhibitor inicjacji Wohlfahrtiimonas chitiniclastica 100 (43/43) sporulacji Sjo, częściowy SH04 ZP_ transpozaza, podjednostka A 68 (26/38) Vibrio cholerae HC-56A1 ZP_ transpozaza, podjednostka B 68 (79/116) Vibrio cholerae TM ZP_ transpozaza dla sekwencji Wohlfahrtiimonas chitiniclastica 81 (69/85) inercyjnej IS431mec SH04 ZP_ potencjalna antytoksyna Wohlfahrtiimonas chitiniclastica 91 (61/67) systemu TA SH04 ZP_ transpozaza z rodziny IS3/IS (65/87) Glaciecola sp. 4H-3-7+YE-5 YP_ element insercyjny IS (139/254) potencjalna toksyna systemu TA hipotetyczne białko o nieznanej funkcji 93 (80/86) 96 (178/186) Wohlfahrtiimonas chitiniclastica SH04 Wohlfahrtiimonas chitiniclastica SH04 Wohlfahrtiimonas chitiniclastica SH04 ZP_ ZP_ ZP_

29 ORF Region kodujący (pz) * Orientacja Wielkość białka (aa) Prawdopodobna funkcja hipotetyczne białko zaangażowane w mobilizację bakterii, endonukleaza VirD1 fosfotransferaza A streptomycyny syntaza dihydropterynianowa hipotetyczne białko o nieznanej funkcji, częściowe hipotetyczne białko o nieznanej funkcji potencjalne białko inicjujące replikację, RepC hipotetyczne białko o nieznanej funkcji Procent identyczności (aminkwasy ) Największe podobieństwo (program BLASTP) Organizm 95 (115/121) Wohlfahrtiimonas chitiniclastica SH04 Numer w GenBank ZP_ (281/282) Haemophilus parasuis ADP (283/283) Actinobacillus pleuropneumoniae YP_ (72/74) Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 YP_ (51/53) Escherichia coli 3431 ZP_ (313/314) Actinobacillus pleuropneumoniae NP_ (99/103) Aeromonas bestiarum ABR białko replikacyjne RepA 90 (431/480) Aeromonas bestiarium YP_ białko partycyjne ParC (61/107) Nitrosomonas eutropha C91 YP_ białko partycyjne Par resolwaza 99 (208/209) Aeromonas bestiarum YP_ (199/199) Aeromonas bestiarum YP_

30 ORF Region kodujący (pz) * Orientacja Wielkość białka (aa) Prawdopodobna funkcja konserwowane hipotetyczne białko o nieznanej funkcji modulator transpozonu Tn21 Procent identyczności (aminkwasy ) Największe podobieństwo (program BLASTP) Organizm Numer w GenBank 88 (59/67) Aeromonas bestiarum ABR (79/81) integraza 100 (337/337) Salmonella enterica subsp. enterica serovar Typhimurium str. T Salmonella enterica subsp. enterica serovar Typhi str. CT18 YP_ NP_ reduktaza dihydrofolianowa 99 (155/157) Escherichia coli NP_ acetylotransferaza aminoglikozydowa 98 (181/185) Escherichia coli NP_ β-laktamaza 99 (290/291) Escherichia coli YP_ białko warunkujące odporność na czwartorzędowe związki 98 (53/54) Pseudomonas aeruginosa AEN amonowe i bromek etydyny transpozaza sekwencji Wohlfahrtiimonas chitiniclastica 96 (170/178) insercyjnej IS431mec SH04 ZP_ represor TetR, białko regulujące ekspresję genów oporności na tertacyklinę 100 (207/207) Actinobacillus pleuropneumoniae YP_

31 ORF Region kodujący (pz) * Orientacja Wielkość białka (aa) Prawdopodobna funkcja białko klasy H warunkujące oporność na tetracyklinę potencjalne białko inicjujące replikację Procent identyczności (aminkwasy ) 100(400/400) 99 (347/350) potencjalna antytoksyna 89 (65/73) potencjalna toksyna 93 (80/86) transpozaza sekwencji insercyjnej IS431mec 96 (170/178) Największe podobieństwo (program BLASTP) Organizm Actinobacillus pleuropneumoniae izolat plazmid p12494 Wohlfahrtiimonas chitiniclastica SH04 Wohlfahrtiimonas chitiniclastica SH04 Wohlfahrtiimonas chitiniclastica SH04 Wohlfahrtiimonas chitiniclastica SH04 Numer w GenBank YP_ ZP_ ZP_ ZP_ ZP_ * - pozycja pierwszego nukleotydu kodonu inicjacyjnego do kodonu stop w sekwencji - aa, aminokwasy - potencjalna funkcja wyznaczona na podstawie porównania domen białkowych - liczba identycznych aminokwasów w odniesieniu do liczby porównywanych; wg programu BLAST Systemy replikacyjne Moduł odpowiedzialny za stabilne utrzymywanie plazmidu w komórce Determinanty oporności Inne ruchome elementy genetyczne zintegrowane z genomem plazmidu 31

32 2.1. Analiza systemów replikacyjnych W sekwencji plazmidu pok1 wyróżniono trzy potencjalne systemy replikacyjne (REP). W skład plazmidowych systemów replikacyjnych wchodzi zazwyczaj gen rep kodujący białko replikacyjne (jeden z systemów pok1 koduje dwa białka) oraz przyległy do tego genu region DNA zawierający origin replikacji, tj. miejsce, w którym dochodzi do zapoczątkowania nowej rundy replikacyjnej. W kolejnych podrozdziałach scharakteryzowano zidentyfikowane systemy System REP1 Otwarta ramka odczytu orf02 (Fig. 1) koduje potencjalne białko replikacyjne (Rep1) systemu REP1. Białko to wykazuje podobieństwo sekwencji aminokwasowej (55%-57%) do białek inicjujących replikację, kodowanych w genomach (i) Acinetobacter lwoffii SH145 (GenBank: EEY ), z Acinetobacter baumannii Naval (GenBank: EKP ) oraz (iii) Acinetobacter johnsonii SH046 (GenBank: EEY ) (sekwencje genomów tych szczepów uzyskano w wyniku sekwencjonowania metodą Shotgun, zatem nie można określić czy geny rep występują w obrębie plazmidów czy chromosomów). Białko Rep1 wykazuje także podobieństwo (na poziomie 45-58%) do plazmidowych inicjatorów replikacji pochodzących ze szczepów Acinetobacter spp. (GenBank: ADM i ADM ) (Bertini i wsp., 2010). Na Fig. 2. przedstawiono porównanie sekwencji aminokwasowych Rep1 z sekwencjami najbardziej podobnych białek. Homologi białka Rep1 są definiowane jako RepB białka inicjujące replikację, wykazujące aktywność topoizomerazy I. Białka o takiej aktywności są najczęściej kodowane w plazmidach replikujących się według mechanizmu toczącego się koła (RC, ang. rolling-circle replication) (Diaz-Orejas i wsp. 1998). Rep1_pOK1 1 VDNTPC TVVKDNVLINASYNLNLVEQRLILLAIVRSRETGKGITANDYLE 50 RepB 1 ---MRDLVV KDNALINASYNLDLVEQRLILLAIVEARESGKGINANNPLE 47 SH MR DLVVKDNALINASYNLDLVEQRLILLAIVEARGSGRGINANDPLE 47 SH MR DLVVKDNALINASYNLDLVEQRLILLAIVEARESGKGINANNPLE 47 Rep1_pOK1 51 IHASDYSDNFKTDRSSTYKSLRDNSKQLFKREFSFI----RGN-ETILSRWVSTIKYCDE 105 RepB 48 VHAEGYINQFGVHRNTAYQALKDACNDLFARQFSYQKINERGNIENYRSRWVSEIGYVDN 108 SH VHAESYVNQFNVARQTAYQALKDACKDLFARQFSYQEVNKRGNIENVLSRWVSEIRYIDD 108 SH VHAESYINQFNVARQTAYQALKDASKDLFARQFSYQEMNKRGNIENVLSRWVSEIRYVDA 108 Rep1_pOK1 106 TATVSLIFSPEVIVFISELEKHFTSYNLQSI SG LTSSYAVRLYEIMSCWKYVQKTPIFGI 168 RepB 109 EAVVKLIFAPAIVPLITRLEEHFTKYELQQVSNLSSAYAVRLYELLIAWRSTGSTPIIEV

33 SH EATVKLIFAPAIVPLITRLEEQFTKYELQQI S DLSSAYAVRLYELLIAWRSTGQTPVIEL 168 SH EATVKLIFAPAIVPLITKLEEQFTKYELQQVSNLSSAYAVRLYELLIAWRSTGQTPVIEI 168 Rep1_pOK1 169 EDFRQRLGVATHEYPRMSNFKTRVLDIAIKQVNTFTNLTVKCEQHKAGRNIIGFSFLIS E 228 RepB 169 SDFRQRIGVLDTEYKRMERFKTSVLELAIKQINEHTDITVKYEQHKRGRSISGFSFTFKQ 228 SH AEFRQKIGVLDDEYTRMGNFKDRVLNLAIAQVNEHTDINVKCEQHKKGRNISGFSFTFKQ 228 SH EEFRKKIGVLDDEYTRMGNFKDRVLHLAMAQVNEFTDITVKYEQHKKGRSIYGFSFSFKQ 228 Rep1_pOK1 229 KKV ERDLNTIDCIDEKPN-EKYITEDEFIALGSDGSDAYEIAIKAFNQGFKIP 281 RepB 229 K KKDNPP--IERDPNTLDLFTKMTDAQRHLFANKLSELP SH K KVIT-----SKSSTSLELFSKMTDAQRHLFANKLSELP SH KK NVNKPNLEARDQNTLDIFTKLTDAQRHLFANKLSELP Rep1_pOK1 282 RNLQIKYGIEGDKFLKAKKSASQKAINTDKNKTTSDKATFIL-NDKTIGYLKKTITDSIN 341 RepB EMGRYSQGTESYPQFAIRIAEMLQDPDRIKELYPYLKKVGYMPSNKKDT SH DMNKYSQGTESYTQFAVRIAEMLQDKERFEELLPYLRKAGFN SH EMSKYSQGTESYPQFAVRIAEMLLDAEKFKELYPYLVKVGFQ Rep1_pOK1 342 KNKHLTNEVKQSFIIVEINEVYDAITTKQNIVDVDNKSVSEMNFKTKMYEAFNIQK 398 RepB VNG 317 SH TK 305 SH TK 311 Fig. 2. Porównanie sekwencji aminokwasowych Rep1 pok1 i białek pokrewnych. Sekwencje porównywane z Rep1 (Rep1_pOK1) pochodzą kolejno z Acinetobacter baumannii Naval (GenBank: EKP ) (RepB), Acinetobacter johnsonii SH046 (GenBank: EEY ) (SH046) oraz Acinetobacter lwoffii SH145 (GenBank: EEY ) (SH145). Na niebiesko zaznaczono aminokwasy identyczne we wszystkich sekwencjach, na szaro identyczne w trzech z nich. Za pomocą kolorowych ramek zaznaczono przewidywaną strukturę drugorzędowa białka Rep1. Obramowaniami otoczono domeny typu winged-helix. Jak widać na Fig. 2, wyróżniona orf2 koduje 398 aa białko. Długość sekwencji białek najbliżej spokrewnionych jest mniejsza i zawiera się w przedziale aa. Region sekwencji konserwowanej w tych białkach nie obejmuje zatem C-końcowej części Rep1. Przeprowadzono również analizę konserwowanych domen białkowych (program InterProScan), dzięki czemu zakwalifikowano białko Rep1 do rodziny Rep_3, grupującej plazmidowe białka inicjujące replikację (Pfam: PF01051). Charakterystyczna dla tej rodziny domena zlokalizowana jest między 7 a 222 aminokwasem Rep1. Ta sama domena znajduje się również w podobnej lokalizacji w najbliższych homologach białka Rep1 (Fig. 2). Wykorzystując programy: PredictProtein, YASPIN i MotifScan nie znaleziono innych konserwowanych motywów w sekwencji Rep1. Nie wyróżniono także potencjalnych motywów helisa-skręt-helisa (HTH, ang. helix-turn-helix) (programy: GYM 2.0 i Helix-Turn-Helix Motif Prediction). Za pomocą programu InterProScan wyznaczono natomiast lokalizację potencjalnych domen typu wingled-helix-turn-helix (Fig. 2). Domena ta jest odpowiedzialna za oddziaływanie z DNA, co wpływa na regulację procesu replikacji (Giraldo i wsp., 2004). Brak motywu HTH jest 33

34 charakterystyczny dla białek replikacyjnych plazmidów replikujących się według mechanizmu toczącego się koła. Zazwyczaj w tych białkach identyfikowany jest potencjalny motyw zamka leucynowego (nieobecny jednak w sekwencji Rep1 pok1) (Diaz-Orejas i wsp., 1998). Region leżący powyżej orf02 uznano jako potencjalne miejsce startu replikacji plazmidu (oriv). Wyróżniono tam region sekwencji bogaty w pary G+C (GCR; pozycja ok bp, średnia zawartość par G+G - 30,9%.) oflankowany przez regiony bogate w pary A+T (ATR1 i ATR2) (Fig. 3). Regiony ATR1 i ATR2 obejmują, odpowiednio, pozycje ok pz i pz, o zawartości par G+C 23,8% oraz 23,6%. Na Fig. 3. przedstawiono organizację regionu oriv plazmidu pok1. W regionie ATR2 występuje 5 prostych, bezpośrednio po sobie 22- nukleotydowych sekwencji powtórzonych (IT1-IT5). Trzy z nich są identyczne, w czwartej występuje punktowa zmiana, natomiast w piątej identycznych jest tylko 5 pierwszych nukleotydów. Prawdopodobnie te sekwencje repetytywne pełnią rolę iteronów, rozpoznawanych specyficznie przez białko Rep1. Sekwencja dwudziestu nukleotydów wchodzących w skład ostatniego iteronu ma strukturę palindromu (Pd). Powyżej iteronów obecna jest także inna sekwencja palindromowa o długości 10 nukleotydów. Należy zauważyć, że w sekwencji iteronów pojawia się 9-nukleotydowa sekwencja 5 -TTATACCAC-3 wykazująca podobieństwo do sekwencji konsensusowej rozpoznawanej przez białko komórkowe DnaA (tzw. DnaA-box) 5 -(T/C)(T/C)(A/T/C)T(A/C)C(A/G)(A/C/T)(A/C)-3 (Schaefer i Messer, 1991). W regionie ATR2 wyróżniono również potencjalną sekwencję promotorową genu rep1 [5 -ATGATA(N 10 )TTTATT-3 ], wykazującą pewne podobieństwo do konsensusu sekwencji promotorów E. coli, rozpoznawanych przez polimerazę RNA związana z podjednostką σ 70 : 5 - TTGACA(N )TATAAT-3 (Harley i Reynolds, 1987). Poniżej sekwencji paromotorowej znajduje się potencjalne miejsce przyłączania rybosomu (rbs): 5 -AGGA-3 (Fig. 3). 34

35 Fig. 3. Organizacja genetyczna potencjalnego oriv plazmidu pok1. Przedstawiono wykres zawartości par G+C w obszarze modułu (Artemis, okno 120 nt), zaznaczono położenie regionów bogatych w pary G+C (GCR) i A+T (ATR1, ATR2) względem genu rep1. W sekwencji wyróżniono iterony (IT), sekwencje palindromu (Pd), sekwencje -10 i -35 oraz miejsce rbs. Gwiazdką zaznaczono brak nukleotydu w iteronie IT4 (konserwowanego w IT1-IT3). Zieloną strzałką zaznaczono początek genu rep System REP2 W skład systemu REP2 wchodzą dwie ORF (orf30 i orf32) kodujące potencjalne białka replikacyjne. Pomiędzy nimi znajduje się orf31, kodujący hipotetyczne białko o nieznanej funkcji. Białko Orf30 wykazuje największe podobieństwo sekwencji aa do białka RepC plazmidu pms260 Actinobacillus pleuropneumoniae (GenBank: NP_ ). Identyczność obu sekwencji wynosi 99%. Badacze opisali to białko jako potencjalnie inicjujące replikację. Co ciekawe, regiony międzygenowe (IGS, ang. intergenic sequence), położone powyżej genów porównywanych białek pok1 i pms260 (GenBank: AB ), wykazują 96% identyczność na poziomie sekwencji nukleotydowej. Zgodnie z adnotacją sekwencji zdeponowanej przez badaczy, powyżej wspomnianego IGS zlokalizowany jest gen kodujący syntazę dihydropterynianową typu II. W przypadku pok1, homologiczne białko (100% identyczność sekwencji aa) kodowane jest przez orf27(sulii), jednak w IGS pomiędzy orf27 a orf30(repc) 35

36 znajdują się dodatkowo dwie ORF (nieobecne w pms20), kodujące hipotetyczne białka o nieznanej funkcji (orf28, orf29) (Fig. 1 i Tabela 4; Fig. 4). Region międzygenowy poprzedzający orf30 wykazuje 99% identyczność sekwencji nukleotydowej z IGS plazmidu pms260. Poniżej odpowiednika orf30, w plazmidzie pms260 zlokalizowany jest gen repa, który nie jest obecny w pok1. W tej pozycji pok1 zlokalizowana jest ORF kodująca hipotetyczne białko o nieznanej funkcji (orf31). Fig. 4. Schemat organizacji genetycznej regionu pok1 flankującego orf30. Kolorowymi ramkami oznaczono ORF: niebieskie kodujące hipotetyczne białka o nieznanej funkcji niewyróżnione w sekwencji plazmidu pms260, fioletowe pochodzące z plazmidu pms260 Actinobacillus pleuropneumoniae (GenBank: NP_ ), żółte wyróżnione w plazmidzie pok1. Inne białka pokrewne Orf30 pochodzą z plazmidów różnych przedstawicieli Gammaproteobacteria: Pasteurella multocida (GenBank: 91% identyczności sekwencji aa, YP_ ), Enterobacter cloacae (91%, GenBank: YP_ ), E. coli (88%, GenBank: YP_ ) i Salmonella enterica (88%, GenBank: YP_ ). Na Fig. 5 przedstawiono porównanie sekwencji aminokwasowych Orf30 i jego najbliższych homologów. Analiza konserwowanych domen białkowych pozwoliła zakwalifikować Orf30 do rodziny białek replikacyjnych RepC (Pfam: PF06504). Charakterystyczna dla niej domena zlokalizowana jest między 35 a 313 aminokwasem Orf30. Ta sama domena znajduje się również w podobnej lokalizacji w najbliższych homologach opisywanego białka (Fig. 5). 36

37 pok1 1 MGHRSKTAGSGGTMAGCSSPPCWRSSARARGCAV VKPKNKHSLSHVRHDPAHCLAPGLFR 60 pleuropneumoniae 1 MGHRSKTAGSGGTMAGCSSPPCWRSSARARGCA VVKPKNKHSLSHVRHDPAHCLAPGLFR 60 cloacae 1 MGHRSKTAGSGGTMAGCSSPLCWSASARARGWPVA KPK--HDLSHARHDPAHCLAPGLFR 58 multocida 1 MGRRSKTAGSGGMTAGCSNPPCWKSSAKARGCA VVKPKNKYSLSHVRHDPAHCLAPGLFR 60 pok1 61 ALKRGERKRSKLDVTYDYGDGKRIEFKGPEPLGADDLRILQGLVAMAGPNGLVLGPEPKT 120 pleuropneumoniae 61 ALKRGERKRSKLDVTYDYGDGKRIEFKGPEPLGADDLRILQGLVAMAGPNGLVLGPEPKT 120 cloacae 59 ALKRGERKRSKLDVTYDYGDGKRIEFSGPEPLGADDLRILQGLVAMAGPSGLVLGPEPKT 118 multocida 61 ALKRGERKRSKLDVTYDYGDGKRIEFKGPEPLGADDLRILQGLVAMAGPNGLVLSPEPKT 120 pok1 121 PGGQQLRLFLEPKWEAVTADAMVVKGSYRALAREVGYADIEDS--RPIRECIERLWTVSI 178 pleuropneumoniae 121 PGGQQLRLFLEPKWEAVTADAMVVKGSYRALAREVGYADIEDS--RPIRECIERLWTVSI 178 cloacae 119 PGGQQLRLFLEPKWEAVETDAMVVKGSYRALAREVGYADIEDS--RPIRECIERLWKVSI 176 multocida 121 EGGQQLRLFLESKWEAVTADAMVVKGSYRALAREIGYAEDGGSQFKAIRECIERLWTVSI 180 pok1 179 IAQNGRKRQGFRLLAEYASDEADGHLYVALNPLIAQAVMGGGLHVRISMDEVRALDSEAA 238 pleuropneumoniae 179 IAQNGRKRQGFRLLAEYASDEADGHLYVALNPLIAQAVMGGGQHVRISMDEVRALDSEAA 238 cloacae 177 IAQHGRKRQGFRLLSEYASDDAEGRLYVALNPLIAQAVMGGGQHVRISMDEVRALDSETA 236 multocida 181 IAQNGRKRQGFRLLAEYASDEAGGRLYVALNPLIAQAVMGGGQHVRISMDEVRALDSEAA 240 pok1 239 RLLHQRLCGWIDPGKTGKASIDTLCSYVWPSEASSSAMRKRRQRVREALPELEALGWSVV 298 pleuropneumoniae 239 RLLHQRLCGWIDPGKTGKASIDTLCSYVWPSEASSSAMRKRRQRVREALPELEALGWSVV 298 cloacae 237 RLLHQRLCGWIDPGKTGKASIDTLCSYVWPSEAVGSAMRMRRKRVREALPELEALGWSVV 296 multocida 241 RLLHQRLCGWIDPGKTGKAAIDTLCGYVWPSEASGSTMRKRRQRVREALPELVALGWTVT 300 pok1 299 EYAAGKYDITRPKAA G 314 pleuropneumoniae 299 EYAAGKYDITRPKAA G 314 cloacae 297 EYAAGKYDIARPKAVG 312 multocida 301 EFAAGKYDITRPKAAG 316 Fig. 5. Porównanie sekwencji aminokwasowych Orf30 i białek pokrewnych. Sekwencje porównywane z sekwencją Orf30 (pok1) pochodzą kolejno z Actinobacillus pleuropneumoniae (GenBank: NP_ ) (pleuropneumoniae), Enterobacter cloacae (GenBank: YP_ ) (cloacae) oraz Pasteurella multocida (GenBank: YP_ ) (multocida). Na niebiesko zaznaczono aminokwasy identyczne we wszystkich sekwencjach, na szaro identyczne w trzech z nich. Kolorowymi ramkami zaznaczono przewidywaną strukturę drugorzędowa białka Orf30. Obramowaniem zaznaczono zakres domeny RepC. Kolejne białko kodowane w obrębie systemu REP2 to Orf32. Wykazuje ono największe podobieństwo sekwencji aa (90%) do białka replikacyjnego (RepA) pochodzącego z plazmidu pab5s9 Aeromonas bestiarum (GenBank: YP_ ). Analiza porównawcza wykazała, że w strukturze plazmidu pok1 znajduje się znacznych rozmiarów segment DNA wykazujący duże podobieństwo (na poziomie sekwencji nukleotydowych) do plazmidu pab5s9 (GenBank; EF ). Fragment ten obejmuje, oprócz orf32, także orf31 (wraz z 37

38 poprzedzającym ją regionem międzygenowym) oraz orf34, orf35, orf36(orf) (Fig. 6). Podobieństwo sekwencji nukleotydowych jest duże i dla poszczególnych ORF wynosi, odpowiednio: 98%, 100%, 96%, 98%, 99%, a na poziomie sekwencji aa kodowanych białek, odpowiednio, 96%, 90%, 99%, 100% i 88% identyczności. orf31 koduje hipotetyczne białko o nieznanej funkcji, orf32 białko replikacyjne, orf34 białko partycyjne ParA, orf35 resolwazę, zaś orf36 konserwowane hipotetyczne białko. Warto zauważyć, że orf33 nie wykazuje podobieństwa sekwencji do sekwencji plazmidu pab5s9 (Fig. 6). orf33 koduje potencjalne białko partycyjne ParC, konserwowane w Plazmidzie2 Nitrosomonas eutropha C91 (GenBank: YP_ ) (patrz rozdział System partycyjny). Fig. 6. Schemat ilustrujący elementy wspólne plazmidów pok1 i pab5s9. Kolorowymi ramkami oznaczono otwarte ramki odczytu: pomarańczowe pochodzące z Plazmidu2 Nitrosomonas eutropha C91 (GenBank: YP_ ), zielone pochodzące z plazmidu pab5s9 Aeromonas bestiarium (GenBank: YP_ ), żółte wyróżnione w plazmidzie pok1. Białka homologiczne Orf32 kodowane są także w plazmidach różnych przedstawicieli Proteobacteria: (i) z klasy Betaproteobacteria Bordetella bronchiseptica (78%, GenBank: CAI ), Achromobacter arsenitoxydans (72%, GenBank: WP_ ), Gammaproteobacteria Pseudomonas areuginosa (74%, GenBank: YP_ ), Xanthomonas arboricola (72%, GenBank: YP_ ) oraz (ii) z klasy Alphaproteobacteria Azospirillum lipoferum 4B (34%, GenBank: YP_ ), Nitrobacter hamburgensis X14 (30%, GenBank: YP_ ). Homologiczne białka kodowane są także w Firmicutes Ammonifex degensii KC4 (37%, GenBank: YP_ ) oraz Geobacillus sp. WCH70 (31%, GenBank: YP_ ). Badacze opisują białka te jako niezbędne do replikacji lub inicjacji replikacji. 38

39 pok1 1 MAAVEQLSLFDRAEEARAYHDPARAGFFSILVDVNGDKRQSSHRLIEMPTVLELIDKSRD 60 aeruginosa 1 MAGQAQLALFEPADEAGTYHDTARTGFFSLLVAVGKDKRQDSYRLTDMPTILGMVDQTRD 60 bestiarum 1 MAAVEQLSLFDRAEEARAYHDPARAGFFSILVDVNGDKRQSSHRLIEMPTVLELIDKSRD 60 bronchiseptica 1 MAAVAQLSLFDRAEEARAYHDPGRSGFFSILVDVHGDKRQSSHRLVEMPTVLELIDKTRD 60 pok1 61 TWLTQAEFIRPNRRVVNLARLGLLFADLDTYRTPWAKGRTPEQLAASVLYHCAQEGIPTP 120 aeruginosa 61 TWLTQAEFMRPNRRVVNLARVGLLFADLDTYRQPWATGRTPEQLAATVLYHCAQEGIPTP 120 bestiarum 61 TWLTQAEFIRPNRRVVNLARLGLLFADLDTYRTPWAKGRTPEQLAASVLYHCAQEGIPTP 120 bronchiseptica 61 TWLTQAEFIRPNRRVVNLARIGLMFADLDTYRQPWATGRTPEQLAASVLYHCAQEGIPTP 120 pok1 121 SMLIFSGRGIQAKWLLDGTIPRQALPRWNACQKYLIDRLRPVGADVAAKDASRVLRLVET 180 aeruginosa 121 SLLVYSGRGIQAKWLLDGTLPRQALPRWNACQRYLVDRLAGLGADPQAKDASRVLRLVST 180 bestiarum 121 SMLIFSGRGIQAKWLLDGTIPRQALPRWNACQKYLIDRLRPVGADVAAKDASRVLRLVET 180 bronchiseptica 121 SLLIFSGRGIQAKWLLDRPVPRQALPRWNACQKYLIDRLMAIGADVAAKDASRVLRLVDT 180 pok1 181 VNSKSGEICRVVHVENGPDGQPVRYSFEYLAEMLLPVARWTIEQQRQERAERR-QLKLLS 239 aeruginosa 181 VNTKSGDVCRVVHVEHGQDGQPVRYGFEYLAEMLLPVARWDIEQQRRDRAERR-QLKLLP 239 bestiarum 181 VNSKSGEICRVVHVENGPDGQPVRYSFEYLAEMLLPVARWTIEQQRQERAERR-QLKLLS 239 bronchiseptica 181 VNTKSGEICRVVHVETGADGQPVRYGFEYLAEMLLPVARWEIEQQREARAERRQQLKLLP 240 pok1 240 GAKTDNLRGFSGRQLAWHRLEDLRKLATLRGGVSEGERMQHLFWRLNFLLLSGATHSSQM 299 aeruginosa 240 GGKADNLRGFSGRQLAWDRLEDLRKLGELRGGVREGERMQHLFWRLNFLLLSGATHSGQM 299 bestiarum 240 GAKTDNLRGFSGRQLAWHRLEDLRKLATLRGGVSEGERMQHLFWRLNFLLLSGATHSSQM 299 bronchiseptica 241 GTKTDNLRGFSGRQLAWHRLEDLRKLATLRGGVQEGERMQHLFWRLNFLLLSGATHSGQM 300 pok1 300 YYEAKALAGELAPPTWAYRDKELMTLYSKAKAYEKGEKISFAGREFAPLYTPKNDTLINL 359 aeruginosa 300 YHEAAALAGELDP-AWSYRSKELMTLYAKAKAYEAGEKVTLGGREFAPLYTPKNDTLISL 358 bestiarum 300 YYEAKALAGELAP-TWAYRDKELMTLYSKAKAYEKGEKISFAGREFAPLYTPKNDTLINL 358 bronchiseptica 301 YHEAKALARELAP-DWQQNSKELMTLYSKAKAYEAGEKITFGGKEYAPLYTPRNDTLINL 359 pok1 360 FQITDDEQRELKTIISKGMAAERHKDREAD-RRRAAGAVDR---ETYLEAAKTKQAQAQE 415 aeruginosa 359 FQITDDEQRKLRTLISSDMAKERDRERHTA-RRRAAGAVDR---ETYLDAAEAKRAQAQA 414 bestiarum 359 FQITDDEQAQLRTIISKGMAKGRDRARKEA-ARRAAGAVDR---ETYLEAANAKQAQAQA 414 bronchiseptica 360 FQITDQEQCELRTIISRDMAAERRRSATESATRPVGGPLVRWIGKTYLEAANTKQAQAQA 419 pok1 416 LREQGMTQKQIAEKMGVGLRSVKRYLAEG AKSVRIT NGEA- 455 aeruginosa 415 LKAEGLSVRAIAQRMGISKSLAAMYAKEAAEC PKSVRITADQAM 458 bestiarum 415 LRAQGLSIRAIAQQMGVSVGSVSGYLKAAPGVQSPSVLQA---DLAGCSKSVRITNGEA- 470 bronchiseptica 420 LREQGLSVRAIAAQMGVSVGSVSGYLKAGASVQSGSPITGAVMEKSGVQSPSPITNGEA- 478 pok HARAVGPA-F 464 aeruginosa 459 PVASIAGSDEGGREGVQSPSVLLMAEPTGRGAV 491 bestiarum HARPVGPAFE 480 bronchiseptica YARPVGPAFE 488 Fig. 7. Porównanie sekwencji aminokwasowych Orf32 i białek pokrewnych. Sekwencje porównywane z sekwencją Orf32 (pok1) pochodzą kolejno z Pseudomonas areuginosa (GenBank: YP_ ) (aeruginosa), Aeromonas bestiarum (GenBank: YP_ ) (bestiarum) oraz Bordetella bronchiseptica (GenBank: CAI ) (bronchiseptica). Na niebiesko zaznaczono aminokwasy identyczne we wszystkich sekwencjach, na szaro identyczne w trzech z nich. Za pomocą kolorowych ramek zaznaczono przewidywaną strukturę drugorzędowa białka Orf32. Czerwoną czcionką zaznaczono aminokwasy tworzące motyw helisa skręt helisa. Obramowaniem zaznaczono fragment domeny należącej do rodziny DeoR. 39

40 Poszukiwanie konserwowanych domem białkowych w sekwencji Orf32 wykazało obecność motywu HTH, odpowiedzialnego za oddziaływanie białka z DNA (HTH Motif Prediction, Pfam). Wykorzystując program Conserved Domain Search (NCBI) wyróżniono domenę charakterystyczna dla regulatorów transkrypcji z rodziny DeoR (COG2390). Obie sekwencje znajdują się w N-końcowej części białka. W białkach homologicznych Orf32 również występuje sekwencja tworząca potencjalny motyw HTH (Fig. 7). Założono, że białka Orf30 i Orf31 stanowią jeden system replikacyjny. Byłby to system podobny do systemów obecnych w plazmidach replikujących się według mechanizmu odsuwanej nici (ang. strand displacement). W układach tego typu występują trzy kodowane plazmidowo białka: RepA, RepB i RepC, wykazujące aktywność, odpowiednio, 5 3 helikazy, prymazy i inicjatora (Sakai i Komano, 1996). W pobliżu genów tych białek powinno znajdować się miejsce startu replikacji oriv, którego w genomie pok1 nie udało się jednak zidentyfikować metodami bioinformatycznymi System REP3 Białko Orf46 systemu REP3 wykazuje największe podobieństwo sekwencji aa (99%) do: (i) potencjalnego białka inicjującego replikację Wohlfahrtiimonas chitiniclastica SH04 (GenBank: ELV ), (ii) do białka replikacyjnego Comensalibacter intestini A911, wyizolowanego z jelita muszki owocowej (GenBank: AGFR ) (63% identyczności) oraz (iii) Acidithiobacillus thiooxidans ATCC (GenBank: AFOH ) (54 % identyczności). Na Fig. 8 przedstawiono porównanie sekwencji aminokwasowych Rep3 z sekwencjami wymienionych białek. Pokrewne białka (55-49% identyczności) kodowane są także w przedstawicielach Alphaproteobacteria (Rhodospirillum rubrum F11, GenBank: AEO ), Betaproteobacteria (Polaromonas naphthalenivorans CJ2, GenBank: ABM ) i Gammaproteobacteria (Arsenophonus nasoniae, GenBank: CBA ). Badania przeprowadzone przy użyciu programu InterProScan pozwoliły na zakwalifikowanie białka Rep3 do rodziny bakteryjnych białek inicjacji replikacji RepA (Pfam: PF10134). Członkowie tej rodziny to białka zdolne do wiązania jednoniciowego DNA, zaangażowane w procesy replikacji, rekombinacji i naprawy DNA. 40

41 Rep3 1 LDMASMEFPLFALKAGDKKIREYCQGDFRIEIVPSVKYGRATIHDKDIWIYCISKLMQAL 60 A911 1 DDIASMEHPLFALKTGDNRVRRYEHNNFSIVIAPNPEYGMATIHDKDIWIYCISKLMQAI 60 ATCC_ DDTASMEHPLFALRAGDKRVRAYKRGNYKVEIQPGP-YGCATIHDKDVWIYCISQLMEAV 59 SH04 1 LDMASMEFPLFALKAGDKKIREYCQGDFRIEIVPSVKYGRATIHDKDIWIYCISKLMQAL 60 Rep3 61 RDG-EEINRTVHFTIYDYLKITNRHICGATYERTKDSLDRLSGTRVTTNIETDKIKEARG 119 A YEE-KEISRTVHFTIYDYLITTNRGVDGRYYEKAKNALDRLRSTNITTNIETAKTREARG 119 ATCC_ NRGRDDISRTVRFVAYDFLVTTNRPVAGVGYDRMADALRRLSGTRIETNIETDGKRERAG 119 SH04 61 RDG-EEINRTVHFTIYDYLKITNRHICGATYERTKDSLDRLSGTRVTTNIETDKIKEARG 119 Rep3 120 FGLIDAWRIVEE-KDGRMIRVSVTLPEWLYRSIASKSVLTINPDYFRLRKPLDRRIYELA 178 A FGLIDAWRVVEE-KDGRMVRVSVTLPDWLYRSVTSNQVLTISPDYFRLRKPLDRRIYELA 178 ATCC_ FGLIDAWKVVERGRDNRMTAVEVTLPDWLFRSVKARHVLTLDRDYFRLRKPLDRRIYEIA 179 SH FGLIDAWRIVEE-KDGRMIRVSVTLPEWLYRSIASKSVLTINPDYFRLRKPLDRRIYELA 178 Rep3 179 RKHCGNNQSWKFNLSTLHQRSGSTASMKEFRKAIKSLAESNQLPDYCVEFDGKKNQVTFV 238 A RKHCGSQKEWKIRLELLLKKTGSSENLREFRRSIKSLVATNELPDYNVFYNLESDLVNFT 238 ATCC_ RKHCGIQPRWRATTATLHEKSGSSATLREFRRLIKGLSDSNELPGYQVVFDHDADVVTFY 239 SH RKHCGNNQSWKFNLSTLHQRSGSTASMKEFRKAIKSLAESNQLPDYCVEFDGKKNQVTFV 238 Rep3 239 KRVCLKDLTEEIKVEAKESKPKRKRITEYEAGQLARPGEEWPDLLKRIGSEYHVIFDQNS 298 A QKYKL ATCC_ PKNGRAGSMAQIRDLLKKPAQTKKKIT SH KRVCLKDLTEEIKVEAKEHRPKRKRITEYEAGQLARPGEEWPDLLKRIGSEYHVIFDQNL 298 Rep3 299 ERQ A V ATCC_ KQA SH ER Fig. 8. Porównanie sekwencji aminokwasowych Rep3 pok1 i białek pokrewnych. Sekwencje porównywane z Rep3 (Rep3) pochodzą kolejno z Comensalibacter intestini A911 (GenBank: AGFR ) (A911), Acidithiobacillus thiooxidans ATCC (GenBank: AFOH ) (ATCC_19377) oraz Wohlfahrtiimonas chitiniclastica SH04 (GenBank: ELV ). Na niebiesko zaznaczono aminokwasy identyczne we wszystkich sekwencjach, na szaro identyczne w trzech z nich. W regionie międzygenowym zlokalizowanym powyżej rep3 znajduje się prawdopodobne miejsce oriv, w którym wyróżniono region bogaty w pary G+C (GCR; bp, zawartość par G+C - 37,2%) oraz poprzedzający go region bogaty w pary A+T (ATR; ok bp, G+C - 26,2%). Na Fig. 9. przedstawiono organizację omawianego regionu. W regionie GCR występują 4 proste, bezpośrednio następujące po sobie 23-nukleotydowe powtórzenia sekwencji, (IT1-IT4) - potencjalne iterony. Trzy z nich są identyczne (IT1-IT3), natomiast czwarte jest mniej konserwowane (pierwszy nukleotyd IT4 jest jednocześnie ostatnim IT3). W regionie GCR wyróżniono ponadto sekwencje potencjalnego promotora genu rep3 5 - TTGACA(N 15 )AATAGC-3 oraz miejsce wiązania rybosomu 5 -AGGA-3.W regionie ATR wyróżniono natomiast 12-nukleotydowy palindrom oraz potencjalne miejsce wiązania białka DnaA o sekwencji 5 -TAATACACA-3 (Fig. 9). 41

42 Fig. 9. Organizacja genetyczna oriv REP3 plazmidu pok1. W górnym panelu przedstawiono profil zawartości par G+C w sekwencji modułu (Artemis, okno 120 nt), zaznaczono położenie regionów bogatych w pary G+C (GCR) i A+T (ATR) względem genu rep3. Barwa paska poniżej sekwencji nukleotydowej obrazuje średnią zawartość par G+C (duża zawartość bordowa). W sekwencji wyróżniono iterony (IT), sekwencje palindromu (Pd), sekwencje -10 i -35 oraz miejsce rbs. Gwiazdką zaznaczono zmiany nukleotydowe w ostatnim iteronie. Zaznaczono prawdopodobne miejsce wiązania białka DnaA. Zieloną strzałką zaznaczono początek genu rep Systemy odpowiedzialne za stabilne utrzymywanie plazmidu w komórce Podczas podziału komórek bakterii, obecne w nich plazmidy ulegają segregacji do komórek potomnych. Plazmidy małe (do kilku tysięcy par zasad) są trwale dziedziczone dzięki występowaniu w komórce w dużej liczbie kopii. W tym przypadku plazmidy segregowane są w sposób losowy, bowiem prawdopodobieństwo, że dany plazmid nie znajdzie się w komórce potomnej jest bardzo małe. Jeśli w komórce, która ulega podziałowi występuje n cząsteczek plazmidowych to prawdopodobieństwo, że żadna z kopii plazmidu nie trafi do komórki potomnej wynosi (0,5) n. Podczas każdego podziału powstają dwie komórki potomne, zatem prawdopodobieństwo, że którakolwiek z nich nie będzie zawierać plazmidu wynosi: P = 2(0,5) n = 2 (1-n) (Nordström i Austin 1989). W naturze, plazmidy występujące w niskiej liczbie kopii są również trwale utrzymywane w populacjach bakterii, niezależnie od obecności presji selekcyjnej. Dzieje się tak dzięki istnieniu specyficznych mechanizmów skutecznie przeciwdziałających utracie plazmidu podczas 42

43 podziału. Wyróżniono trzy grupy tego typu systemów. Do pierwszej należą systemy miejscowospecyficznej rekombinacji (MRS), które działają przed podziałem komórki (Fig. 10A). Dzięki nim formy oligomeryczne plazmidów (powstałe m.in. w skutek rekombinacji pomiędzy cząsteczkami plazmidów) są rozdzielane do samodzielnych monomerów. Z kolei wzrost liczby monomerów w komórce optymalizuje ich losową segregację do komórek potomnych. Drugą grupę stanowią systemy aktywnego rozdziału plazmidów (partycji; PAR) do komórek potomnych (Fig. 10B). Działają one w trakcie podziału komórki. Trzecia grupa to systemy addykcyjne (TA), których działanie polega na "uzależnieniu" komórek gospodarza od występującego w nich plazmidu (Fig. 10C). Powodują one eliminację komórek bezplazmidowych, ich działanie jest zatem widoczne na poziomie populacji. Systemy należące do drugiej i trzeciej grupy zapewniają dziedziczenie lepsze niż losowe. Fig. 10. Mechanizmy stabilnego dziedziczenia plazmidów. (A) Miejscowo-specyficzna rekombinacja; ciemne kółka na plazmidach oznaczają miejsca res; litera x pomiędzy plazmidami lub wewnątrz dimeru plazmidowego oznacza zachodzenie rekombinacji. (B) Partycja; jasne prostokąty oznaczają tzw. miejsca centromerowe. (C) Mechanizm addykcyjny czyli posegregacyjna eliminacja komórek bezplazmidowych; kontury narysowane przerywaną linią oznaczają śmierć komórki na skutek utraty plazmidu (Zielenkiewicz i Cegłowski, 2002). W przypadku plazmidów występujących w 1-2 kopiach w przeliczeniu na chromosom gospodarza, występują często wszystkie trzy opisane wyżej rodzaje mechanizmów stabilizujących. W kolejnych podrozdziałach przedstawiono opis systemów tego typu zidentyfikowanych w genomie plazmidu pok System partycyjny Systemy aktywnego rozdziału (PAR), nazywane partycyjnymi, to typowe komponenty plazmidów niskokopiowych. Warunkują one początkowo odpowiednie umiejscowienie cząsteczek plazmidów w komórce. Do prawidłowego przebiegu tego procesu niezbędna jest obecność dwóch białek partycyjnych oraz sekwencji centromeropodobnej, specyficznej dla 43

44 danego systemu PAR. Homologi plazmidowych białek partycyjnych kodowane są również w chromosomach bakterii, i prawdopodobnie uczestniczą w ich rozdziale. Mechanizm aktywnej partycji jest zatem bardzo pierwotny, z ewolucyjnego punktu widzenia (Gerdes i wsp., 2000). Niektóre z systemów PAR funkcjonują w różnych gospodarzach, niekiedy nawet po przeniesieniu z bakterii gramujemnych do gramdodatnich (Yamaichi i Niki, 2000). W sekwencji plazmidu pok1 wyróżniono 5 ORF (orf11, orf12, orf16, orf33 oraz orf34; Fig. 1) wykazujących podobieństwo sekwencji do ORF białek partycyjnych. Należy podkreślić, że orf16 jest niekompletna i koduje jedynie 43 aminokwasy identyczne z N-końcową częścią orf11. Brak pozostałej części sekwencji orf16 może wynikać z wbudowania się w obrębie tej ramki sekwencji insercyjnej, zawierającej orf17 i orf18 (Fig. 1). Sekwencja aminokwasowa Orf11 wykazuje na 99% podobieństwo z sekwencją ORF Wohlfahrtiimonas chitiniclastica SH04, opisanej jako inhibitor inicjacji sporulacji Soj. Na podstawie analiz porównawczych in silico sekwencji Orf11, białko to można zaliczyć do rodziny CbiA białek typu CopQ/CopB/MinD/ParA wiążących się z DNA (Pfam: PF01656). Inne białka pokrewne Orf11 (podobieństwo 70-78%) zostały opisane jako białka partycyjne ParA plazmidów i pochodziły z różnych gatunków bakterii. W N-końcowej części tych białek zidentyfikowano zmieniony motyw Walkera A: 5 KGG(S/A)GKT 3, tworzący tzw. pętlę P, odpowiadającą za wiązanie ATP (Lutkenhaus i Sundaramoorthy, 2003) oraz aminokwasy zaangażowane w wiązanie jonów magnezu (NCBI Conserved Domain Search) (Fig. 11). Potencjalne białko Orf12 wykazuje identyczność sekwencji na poziomie 47-53% do białek partycyjnych ParB. We wszystkich tych białkach obecna jest charakterystyczna domena typu ParG (Pfam: PF09274). Podobnej domeny nie udało się zidentyfikować w sekwencji wyróżnionej w plazmidzie pok1. W tej domenie występuje motyw wstęga-helisa-helisa warunkujący wiązanie się z DNA (Golovanov i wsp., 2003). Motyw ten jest obecny w sekwencji Orf12 (analiza przy użyciu programu InterProScan), co może wskazywać na funkcjonalność tego białka. Na podstawie przedstawionych wyżej wyników analiz porównawczych wydaje się, że produkty orf11 i orf12 kodują, odpowiednio, potencjalne białka typu ParA i ParB. Analiza sekwencji aminokwasowych tych białek pozwala określić je jako składniki systemu partycyjnego typu Ib (Ebersbach i Gerdes, 2005). Wskazuje na to: (i) typowa wielkość białek ( aa dla ParA, aa dla ParB), (ii) obecność zmienionego motywu Walkera w N- końcowej części białka ParA oraz brak motywu HTH, (iii) słabe konserwowanie sekwencji aminokwasowej białka ParB. orf11 i orf12 znajdują się w tej samej orientacji transkrypcyjnej, odległość między nimi wynosi 61 pz. Możliwe jest, że tworzą one operon, co jest cechą 44

45 charakterystyczną systemów PAR. W systemach partycyjnych typu Ib sekwencja centromeropodobna (pars), rozpoznawana przez białko ParB, znajduje się zazwyczaj powyżej operonu. Składa się ona z kolejno ułożonych prostych powtórzeń sekwencji (Ebersbach i Gerdes, 2005). W sekwencji plazmidu pok1 nie zidentyfikowano sekwencji o takiej strukturze - zarówno poniżej, jak i powyżej genów operonu. pok1 1 MKVISVLNQ KGGSGKT TIATHLARCIHNAGSSVLLVDSDPQGSARDWSAVNEENPITVIG 60 SH04 1 MKVISVLNQ KGGSGKT TIATHLARCIHNAGSSILLVDSDPQGSARDWSAVNEENPITVIG 60 axonopodis 1 MKVIAVLNQ KGGSGKT TIATHLARALQLAGADVLLVDSDPQGSARDWAAVREDQPLTVVG 60 oboediens 1 MKVIAVLNQ KGGSGKT TIATHLARALQIGGADVLLVDSDPQGSARDWAAVREEQPVTVVG 60 pok1 61 IDRPTIDRDLKAISNKDFIVIDGAPQTADLAISAIKASDFILIPVQPSPYDIWATSDLVD 120 SH04 61 IDRPTIDRDLKAISNKDFIVIDGAPQTADLAISAIKASDFILIPVQPSPYDIWATSDLVD 120 axonopodis 61 IDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIPVQPSPYDIWATADLVE 120 oboediens 61 IDRPTIERDLKNIARKDFVVIDGAPQAADLAVSAIKASDFVLIPVQPSPYDIWATSDLVD 120 pok1 121 LVKQRIEMTDGKLKVAFVVSRAITGTKIGHEIHEALEGYELPILTTRITQRISYPSSAAL 180 SH LVKQRIEMTDGKLKVAFVVSRAITGTKIGHEIHEALEGYELPILTTRITQRISYPSSAAL 180 axonopodis 121 LVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPILESRITQRVSYPGTAAA 180 oboediens 121 LVKQRIEVTDGKLQAAFVVSRAIKGTRIGAEITEALKGYGLPILESRITQRVSYPGTAAG 180 pok1 181 GKTVFDIEPKGEASKEILNLYNEIMDEYLSK 211 SH GKT V 184 axonopodis 181 GTTVLESEPEGDAAREVQALAAEIKSKL--I 209 oboediens 181 GSTVMDVEPGSDASKEILSLSNEIKRKL--I 209 Fig. 11. Porównanie sekwencji aminokwasowych Orf11 i białek pokrewnych. Sekwencje porównywane z sekwencją wyróżnioną w plazmidzie pok1 pochodzą kolejno z Wohlfahrtiimonas chitiniclastica SH04 (GenBank: WP_ ) (SH04), Xanthomonas axonopodis (GenBank: WP_ ) (axonopodis) oraz Gluconacetobacter oboediens (GenBank: WP_ ) (obodiens). Na niebiesko zaznaczono aminokwasy identyczne we wszystkich sekwencjach, na szaro identyczne w trzech z nich. Kolorowymi ramkami zaznaczono przewidywaną strukturę drugorzędowa opisywanego białka. Obramowaniem zaznaczono aminokwasy tworzące zmieniony motyw Walkera. Żółta czcionką zaznaczono aminokwasy zaangażowane w wiązanie jonów magnezu. Potencjalny produkt białkowy orf33 również wykazuje podobieństwo sekwencji aa do białek partycyjnych. Najbliższym homologiem (podobieństwo sekwencji 57%) jest białko pochodzące z Nitrosomonas eutropha C91, opisane jako białko partycyjne C (GenBank: YP_ ), o długości identycznej z Orf33. Zarówno w sekwencji Orf33, jak i jego homologów, nie wyróżniono żadnych konserwowanych domen białkowych ani motywów sekwencji (analiza porównawcza programami: Pfam, NCBI Conserved Domain Search, InterProScan). Kolejna ORF (orf34) koduje potencjalne białko, wykazujące podobieństwo sekwencji (99%) do białka ParA plazmidu pab5s9 Aeromonas bestiarum (GenBank: 45

46 YP_ ). Inne pokrewne białka również zostały opisane jako białka o aktywności ATPaz, zaangażowane w partycje plazmidów lub chromosomów. W sekwencji Orf34 oraz w sekwencjach pokrewnych białek możliwe jest wyróżnienie zmienionego motywu Walkera oraz miejsc odpowiedzialnych za wiązanie jonów magnezu (tak jak w przypadku orf11). Również w tym przypadku analiza porównawcza pozwoliła zaliczyć Orf34 do rodziny CbiA białek typu CopQ/CopB/MinD/ParA wiążących się z DNA (Pfam: PF01656) (Fig. 12). pok1 1 MIIGVLNQ KGGVGKT TLSVNIAAALAHSGARVLLIDADPQGSSLDWSAAREGDPIFSVVG 60 bestiarum 1 MIIGVLNQ KGGVGKT TLSVNIAAALAHSGARVLLIDADPQGSSLDWSAAREGDPIFSVVG 60 savastanoi 1 MIIGVLNQ KGGVGKT TLSVNIAAALAQGGARVLLIDADPQGSSLDWSAAREGEPLFSVVG 60 variicoloris 1 MIVGLLNQ KGGVGKT TLSVNLAASLARTGARVLLIDADPQGSALDWAAAREGEPLFSVVG 60 pok1 61 LPRASVHKEIGQVGQGYDHIIIDGPPRVTDLARSAIMASDLVLIPVQPSPYDVWAADEVV 120 bestiarum 61 LPRASVHKEIGQVGQGYDHIIIDGPPRVTDLARSAIMASDLVLIPVQPSPYDVWAADEVV 120 savastanoi 61 LPRPSIHKEISQVGKGYDHIIIDGPPRVTDLARSAIMASDVVLIPVQPSPYDIWAADEVV 120 variicoloris 61 LPRPTVHKEIGQIGHGYDHIIIDGPPRVTDLARSAIMAADVVLIPVQPSPYDIWAADEVV 120 pok1 121 KLIQEATVYKENLKSAFVVNRKIANTAIGRDVGEALAAYEMPILTSTVTQRVIYAEAAAQ 180 bestiarum 121 KLIQEATVYKENLKSAFVVNRKIANTAIGRDVGEALAAYEMPILTSTVTQRVIYAEAAAQ 180 savastanoi 121 KLVQEATVYKEKLKYAFVVNRKIANTAIGRDVGDALAAYPVPVLSSTITQRVIYAEAAAQ 180 variicoloris 121 KLIEEARVYKENLKSAFVVNRKIANTAIGRDVGEALAAYPVPALVASITQRVVFAEAAAQ 180 pok1 181 GKAVFEIDTVGPAAAEIAALVAEILEFAK 209 bestiarum 181 GKAVFEIDTAGPAAAEIAALVAEILEFAK 209 savastanoi 181 GKAIFEIAAEGPATAEIQTLVAELLEFGK 209 variicoloris 181 GRAVHEIDGQGPAAAEIEAMRAELMEFAR 209 Fig. 12. Porównanie sekwencji aminokwasowych Orf34 białek pokrewnych. Sekwencje porównywane z sekwencją wyróżnioną w plazmidzie pok1 pochodzą kolejno z Aeromonas bestiarum (GenBank: YP_ ) (bestiarum), Pseudomonas savastanoi (GenBank: WP_ ) (savastanoi) oraz Singularimonas variicoloris (GenBank: WP_ ) (variicoloris). Na niebiesko zaznaczono aminokwasy identyczne we wszystkich sekwencjach, na szaro identyczne w trzech z nich. Kolorowymi ramkami zaznaczono przewidywaną strukturę drugorzędowa Orf34. Obramowaniem zaznaczono aminokwasy tworzące zmieniony motyw Walkera. Żółta czcionką zaznaczono aminokwasy zaangażowane w wiązanie jonów magnezu. Analiza porównawcza wskazuje, że produkt białkowy Orf34 to składnik systemu partycyjnego Ib, o czym świadczą: typowa wielkość białka (209aa), obecność zmienionego motywu Walkera w części N-końcowej oraz brak motywu HTH. Ponieważ w sekwencji pok1 nie wyróżniono w pobliżu orf34 potencjalnego genu kodującego białko ParB możliwe jest, że jest to system defektywny. Jest mało prawdopodobne, aby opisywana wcześniej orf33 mogła kodować białko typu ParB. Oba potencjalne geny znajdują się w znacznej odległości od siebie 46

47 315 pz. Zarówno powyżej, jak i poniżej opisywanych ORF, nie zidentyfikowano potencjalnej sekwencji centromeropodobnej Systemy toksyna-antytoksyna Komórki pozbawione plazmidów pojawiają się w populacji z niską częstością, co jest, między innymi, wynikiem działania systemów toksyna-antytoksyna (TA), warunkujących posegregacyjną eliminację komórek bezplazmidowych. Podstawą funkcjonowania systemów TA jest kodowanie dwóch czynników - jednego wywołującego efekt toksyczny (toksyna), oraz drugiego - nietrwałej antytoksyny (odtrutki), przeciwdziałającej działaniu toksyny. Stężenie antytoksyny w komórce jest zazwyczaj większe niż toksyny. Toksyną zawsze jest białko, a antytoksyną może być białko lub antysensowny RNA. W komórce plazmidowej zachodzi ciągła synteza antytoksyny, która tworzy stabilny kompleks z toksyną, co zapobiega ekspresji efektu toksycznego. Z chwilą utraty plazmidu, ilość antytoksyny szybko ulega zmniejszeniu (degradacja przez proteazy komórkowe Lon lub Clp), co powoduje uwolnienie toksyny z kompleksu lub rozpoczęcie jej syntezy. Komórka bezplazmidowa jest eliminowana, a w populacji pozostają jedynie komórki posiadające plazmid. Zazwyczaj białko antytoksyny zawiera dwie domeny: (i) odpowiedzialną za wiązanie DNA oraz (ii) za interakcje z toksyną (Brown i wsp., 2009). Systemy TA występują także powszechnie, często w wielu kopiach, w chromosomach bakteryjnych (Gerdes, 2000). Wykazano zaangażowanie tych systemów w odpowiedzi ścisłej na warunki stresowe. Funkcją chromosomowych systemów TA jest dostosowanie poziomu syntezy makromolekuł (białek, DNA) do ilości dostępnych składników odżywczych. Ich aktywacja, w zależności od rodzaju systemu, może obniżyć poziom replikacji lub translacji, co prowadzi do zmniejszenia tempa metabolizmu (Gerdes i wsp., 2005). Wykazano, że chromosomowe homologi genów systemów TA, po przeniesieniu do plazmidów zwiększają ich stabilność (Aizenman i wsp., 1996). W sekwencji plazmidu pok1 wyróżniono trzy systemy TA. Wszystkie wykazują największą identyczność sekwencji aa, na poziomie %, z systemami zidentyfikowanymi w genomie szczepu Wohlfahrtiimonas chitiniclastica SH04. Dwa systemy są identyczne. Wszystkie zidentyfikowane loci to dwugenowe układy, w których gen antytoksyny poprzedza gen toksyny. Na Fig. 13 przedstawiono schemat organizacji omawianych systemów TA. 47

48 Fig Fig. 13. Schemat organizacji genetycznej systemów TA wyróżnionych w genomie plazmidu pok1. Kolorowymi strzałkami zaznaczono ORF systemów TA (ant gen antytoksyny, tox gen toksyny) oraz sekwencji inercyjnych (IS), wbudowanych w jeden z układów. Kolorową czcionką zaznaczono potencjalne sekwencje promotorów. Analizowane systemy wykazują wyraźne podobieństwo do systemów, w których zarówno toksyna jak i antytoksyna są białkami. Systemy te należą zatem do II typu systemów TA (Yamaguchi i Inouye, 2009). Kompleks toksyny i antytoksyny lub sama antytoksyna działa jako represor transkrypcji operonu TA, poprzez wiązanie się do palindromowej sekwencji znajdującej się w regionie promotorowym operonu. Wiązanie to jest możliwe dzięki domenie obecnej w antytoksynie, o strukturze wstążki-helisy-helisy lub HTH (Brown i wsp., 2009). W większości przypadków gen antytoksyny poprzedza gen toksyny. Przewidywane białkowe produkty orf14 i orf15 pok1 (Pfam: PF02604, PF06769) wykazują 100% podobieństwo sekwencji do białek toksyny YoeB i antytoksyny YefM (system yoeb-yefm) (Zhang i Inouye, 2009). Antytoksyna YefM jest wysoce niestabilna, co wynika z jej degradacji przez proteazę Lon oraz ATP-zależne proteazy serynowe. Wykazano, że białko to w czystej formie istnieje w postaci zdenaturowanej, bez struktury drugorzędowej. Gdy YefM podlega ekspresji wraz z toksyną YoeB, dimer YefM tworzy stabilny kompleks z cząsteczką YoeB (Cherny i Gazit, 2004). YoeB łączy się z podjednostką 50S rybosomu, specyficznie blokując tworzenie 48

49 kompleksu inicjatorowego. Oczyszczona toksyna YoeB wykazuje aktywność endorybonukleazy (Zhang i Inouye, 2009). Na Fig. 14 i Fig. 15 przedstawiono porównanie sekwencji aminokwasowych omawianych białek z ich najbliższymi homologami. ant\sh04 1 MHVFTYTDARNNLKSVLDKVVDDADVAFITRKEGGHAVVMGQDHYNSLMETLYLLSSPNN 60 ANC 1 MHVFTYTDARNNLKSVLDKVIDDADVAFITRKEGGHAVVMGQDHYDSLMETLYLLSSPNN 60 CIP 1 MHVFTYTDARNNLKSVLDKVIDDVDVAFITRKEGGHAVVMGQDHYDSLMETLYLLSSPNN 60 Naval-82 1 MHVFTYTDARNNLKSVLDKVIDDADVAFITRKEGGHAVVMGQDHYDSLMETLYLLSSPNN 60 ant\sh04 61 TNRLNESIAQLRSGQVTIRELIED--E 85 ANC 61 TTRLNESIAQLRAGKTKQRELIIDDES 87 CIP 61 ASRLNESIAQLRAGKTKHRELIEDDES 87 Naval TTRLNESIAQLRAGKTKQRELIKDDES 87 Fig. 14. Porównanie sekwencji aminokwasowych białka antytoksyny Orf15 i białek pokrewnych. Sekwencje porównywane z sekwencją antytoksyny (identyczna z sekwencją pochodzącą z Wohlfahrtiimonas chitiniclastica SH04) (ant\sh04) pochodzą kolejno z Acinetobacter indicus 4215 (GenBank: EPF ) (ANC), Acinetobacter sp. CIP (GenBank: WP_ ) (CIP) oraz Acinetobacter baumannii (GenBank: WP_ ) (Naval-82). Na niebiesko zaznaczono aminokwasy identyczne we wszystkich sekwencjach, na szaro identyczne w trzech z nich. Za pomocą kolorowych ramek zaznaczono przewidywaną strukturę drugorzędowa opisywanego białka antytoksyny (YefM). tox\sh MNSRNIEWTSNSWDEYIYWQTQDKKILKRINSLIKECQRTPFEGTGKPEPLKANLSGF 58 AYE 1 MRMTNRNVEWTDNAWDEYIYWQTQDKKILKRINTLIKECQRTPFEGTGKPEPLKANLSGF 60 CIP 1 --MTSRNVEWTENAWDEYIYWQTQDKKILKRINTLIRECQRTPFEGTGKPEPLKANLSGF 58 baumannii 1 --MTSRNVEWTENAWDEYIYWQTQDKKILKRINTLIRECQRTPFEGTGKPEPLKANLSGF 58 tox\sh04 59 WSRRIDEKHRLVYEVTDEKISIVQCRFHY 87 AYE 61 WSRRIDEKHRLVYEVTDERISIIQCRFHY 89 CIP 59 WSRRIDEKHRLVYEVTDERISIVQCRFHY 87 baumannii 59 WSRRIDEKHRLVYEVTDERISIIQCRFHY 87 Fig. 15. Porównanie sekwencji aminokwasowych białka toksyny Orf14 i białek pokrewnych. Sekwencje porównywane z sekwencją toksyny (identyczna z sekwencją pochodzącą z Wohlfahrtiimonas chitiniclastica SH04) (tox\sh04) pochodzą kolejno z Acinetobacter baumannii AYE (GenBank: YP_ ) (AYE), Acinetobacter junii CIP (GenBank: ENV ) (CIP) oraz Acinetobacter baumannii (GenBank: WP_ ) (baumanii). Na niebiesko zaznaczono aminokwasy identyczne we wszystkich sekwencjach, na szaro identyczne w trzech z nich. Za pomocą kolorowych ramek zaznaczono przewidywaną strukturę drugorzędowa opisywanego białka toksyny (YoeB). W systemie orf14-orf15 pok1 gen antytoksyny (o długości 258 pz) nakłada się (8 nukleotydów) na gen toksyny (264 pz). Przed operonem zidentyfikowano potencjalny promotor (Fig. 13), nie występuje tam jednak sekwencja palindromowa, konserwowana w innych systemach TA, (warunkująca oddziaływania z represorem). Kolejny system TA pok1 tworzą orf20 i orf23. Ich produkty białkowe wykazują największe podobieństwo do hipotetycznych białek kodowanych w genomie Wohlfahrtiimonas chitiniclastica. Pokrewne białka (50-70% identyczności sekwencji) to antytoksyny i toksyny z 49

50 rodziny RelB-RelE. Na Fig. 16 i Fig. 17 przedstawiono porównanie omawianych sekwencji z białkami im pokrewnymi. W genomie pok1 gen antytoksyny i toksyny zostały rozdzielone w wyniki transpozycji dwóch sekwencji insercyjnych, co spowodowało rozerwanie ciągłości genu antytoksyny (przewidywane skrócenie białka z 73 do 68 aminokwasów). Prawdopodobnie system ten nie jest funkcjonalny. Identyczny moduł TA występuje również w innej lokalizacji pok1 (orf47 i orf48) (Fig. 1 i Fig. 13), nie jest on jednak zinaktywowany przez IS. ant 1 MSIISIRLNDYEANLFKEYAAFHGESLSSLFKASLLEKMEDELDLKLLEEAIIYNEKHPE MT-ISVRLSERDAKLFKTYADINGISMSELIRSSVLERIEDEYDIKIYEEAMKEYLSDPE 59 SH04 1 MSIVSIRLNDHEANLFKEYAEFHGASLSSLFKASLLEKMEDELDIKLLEEAIIYNKKHPE 60 ureolytica 1 MSIISVRLNATEERLFTEYAEFHGKSLSTLLKESLAEKMEEELDAKLLVEAKEYNKKNPE 60 ant 61 TYTHDEVKKALGL TYSMDEVEKELGL 73 SH04 61 TYTHDEVRKVLGL 74 ureolytica 61 TYTHQQVKEKLGL 74 Fig. 16. Porównanie sekwencji aminokwasowych białka antytoksyny Orf20 i białek pokrewnych. Sekwencje porównywane z sekwencją antytoksyny pok1 (ant) pochodzą kolejno z Clostridiales bacterium (GenBank: WP_ ) ( ), Wohlfahrtiimonas chitiniclastica SH04 (GenBank: ELV ) (SH04) oraz Oligella ureolitica (GenBank: WP_ ) (ureolitica). Na niebiesko zaznaczono aminokwasy identyczne we wszystkich sekwencjach, na szaro identyczne w trzech z nich. Kolorowymi ramkami zaznaczono przewidywaną strukturę drugorzędowa opisywanego białka antytoksyny. tox 1 M-YQVIYTAKAVKSLKKIDKTQAKLILSWIEKNLIGCSDPRIKGKEIKGDL-ADWRYRVG 58 MJ3 1 MSYQVVYTKKAIKSLKKVDKAQQRLIIAWIEKHLINAKDPRALGKALKEDLKAYWRYRVG 60 SH04 1 M-YQVIYTAKALKSLKKIDKTQAHLILNWIEKNLIGCSDPRIKGKEIKGNL-ADWRYRVG 58 ureolytica 1 M-FQVIYTAKALKSLSKLDKTQARLIVAWIEKNLVNSSNPRFTGKNIKGDL-ADWRYRVG 58 tox 59 DYRLLCNILDEEIIIEVINVGHRKDIYK 86 MJ3 61 DYRILADINDNEIKIIVFNIGHRKDIYE 88 SH04 59 DYRLLCNISDEEITIEVINVGHRKDIYK 86 ureolytica 59 NYRILCHIIDQTITIEVVNIGHRKDIYK 86 Fig. 17. Porównanie sekwencji aminokwasowych białka toksyny Orf23 i białek pokrewnych. Sekwencje porównywane z sekwencją toksyny pok1 (tox) pochodzą kolejno z Salimicrobium sp. MJ3 (GenBank: WP_ ) (MJ3), Wohlfahrtiimonas chitiniclastica SH04 (GenBank: ELV ) (SH04) oraz Oligella ureolitica (GenBank: WP_ ) (ureolytica). Na niebiesko zaznaczono aminokwasy identyczne we wszystkich sekwencjach, na szaro identyczne w trzech z nich. Kolorowymi ramkami zaznaczono przewidywaną strukturę drugorzędowa opisywanego białka toksyny. System relbe jest jednym z najlepiej poznanych systemów TA. Toksyna (RelE) oddziałuje z miejscem A rybosomu, powodując przecięcie mrna pomiędzy drugim a trzecim nukleotydem kodonu stop, co prowadzi do zahamowania translacji (Pedersen i wsp., 2003). Wykazano, że RelE przecina mrna na początku regionu kodującego (pierwsze sto kodonów) 50

51 (Hurley i wsp,. 2011). Sama toksyna RelE nie ma aktywności endorybonukleolitycznej, uważa się jednak że jest czynnikiem oddziałującym z rybosomem, stymulującym jego endogenną aktywność rybonukleolityczną (Pedersen i wsp., 2003). Białka RelE i RelB tworzą tetrameryczny kompleks, w którym cząsteczka RelB okala cząsteczkę RelE. W pełni funkcjonalne homologi systemu relbe są znajdowane w szczepach bakteryjnych oraz u archeonów, zarówno w chromosomach, jak i w plazmidach. W sekwencji antytoksyny pok1 nie znaleziono żadnej konserwowanej domeny. W sekwencji toksyny znajduje się domena charakterystyczna dla białek systemów stabilizujących plazmid (Pfam: PF05016). Do tej rodziny należą białka systemów parde oraz relbe System restrykcji-modyfikacji Systemy restrykcji modyfikacji (R-M) występują powszechnie u Procaryota. Geny tych systemów identyfikuje się zarówno w chromosomach, jak i w plazmidach. Systemy R-M składają się zazwyczaj jedynie z genów kodujących dwa enzymy: (i) endonukleazę (REaza), rozpoznającą specyficzną sekwencję w DNA oraz (ii) metylotranferazę (MTaza), która poprzez metylację tej sekwencji, zabezpiecza ją przed przecięciem przez endonukleazę. Uważa się, że obecność tego typu systemu zabezpiecza komórkę przed inwazją obcego DNA. Udowodniono, że obecność genów systemów R-M (np. EcoRI lub PaeR7) w plazmidzie zwiększa jego stabilność segregacyjną (Naito i wsp., 1995). Systemy te, podobnie jak systemy TA, funkcjonują na zasadzie posegregacyjnego zabijania komórek bezplazmidowych. W tym wypadku obydwa enzymy - endonukleaza (odpowiednik toksyny) i metylotransferaza (odpowiednik antytoksyny) są stabilnymi białkami. Efekt toksyczny objawiający się w komórkach bezplazmidowych (pozbawionych systemu R-M) polega, w tym przypadku, na stopniowym rozcieńczaniu białek endonukleaz i metylotransferazy w kolejnych podziałach komórkowych. W rezultacie nie wszystkie sekwencje genomu są metylowane, a wówczas nawet śladowa aktywność endonukleazy wystarcza do przecięcia sekwencji i rozerwania ciągłości genomu. W sekwencji plazmidu pok1 wyróżniono dwie ORF systemu R-M: (i) orf05 kodująca MTazę i orf07 - kodująca REazę. Obie ORF ułożone są w tej samej orientacji transkrypcyjnej (Fig. 1). ORF kodująca potencjalną metylotransferazę wykazuje największą identyczność sekwencji aa (58%) do metylotransferazy N-4/N-6 pochodzącej z Acinetobacter sp. HA (GenBank: WP_ ), opisanej jako adenino-zależna metylotransferaza Mod. Inne białka homologiczne Orf5 pok1 pochodzą z różnych szczepów Acinetobacter spp., a także z innych bakterii reprezentujących różne klasy taksonomiczne. Białka te opisywane są jako 51

52 metylotransferazy systemów restrykcyjnych typu III. Na Fig. 18 przedstawiono porównanie sekwencji aminokwasowych omawianego białka oraz białek pokrewnych. pok1 1 MSIQFLALVAKLKEIFQINRPDLDFGVYRILNARSKEIEEFLNQRLKKKVEISLQESAQS 60 HA 1 MSTQFSALVSKLKEIFQINRPDLDFGVYRILNSRSDEIAEFLDKRLKTKVEQYLGEAKSS 60 MTCC 1 MSTQFSALVSKLKEIFQINRPDLDFGVYRILNARSTEIAEFLDKRLKTKVEQYLGEAKSS 60 aquimarina 1 MS-KYNELVKKLKEIFQIDKPELDFGIYRILNAKADEINNYLENTLKKKISDALASAGNA 59 pok1 61 LDQNALKDLEDELRDEYGKRAFDEFGELVDTEALNSRVGKKYLALKNSGANQYADESQVY 120 HA 61 LDENAIKELEAELKAEFGKRAFNEQGELIDAEAIESALGQKYIALTQADAHEMTDQSQVY 120 MTCC 61 LDENVLKELEAELKAEFGKRAFNEQGELIDQEAIESALGQKYIALTQADAHEMTDQSQVY 120 aquimarina 60 NKEELERQLAEAIKNAEGA-GFNPD----DSPKVKDLRAQ--ITASSQGANE--HENAVF 110 pok1 121 NHLLTFFSRYYDEGDFISQRRYKGDTYAIPYSGEEVMLHWANKDQYYTKSGEMFSNYRFK 180 HA 121 SHLLTFFSRYYDEGDFISQRRYKGDTYAIPYSGEEVMLHWANKDQYYTKSGEMFSNYRFK 180 MTCC 121 SHLLTFFSRYYDDGDFISQRRYKGDTYAIPYSGEEVMLHWANKDQYYTKSGEMFSNYRFK 180 aquimarina 111 THLLTFFSRYYDSGDFVSKRRYKGDTYAIPYAGEEVMLHWANKDQYYIKSGENFSNYSFK 170 pok1 181 LANGKSVLFKLLSADTARENRKDNDKNRCFNLVTEVRTIVKYDEDGEEYEEVIQPFEI HA 181 LNDERSVLFRLVSADTARENRKDNDKDRRFIIVTEPKTFTRIDEDGEEFEETIVPFSI MTCC 181 LNDERSVLFRLVSADTARENRKDNDKDRRFIIVTEPKTFTRIDEDGEEFEETIVPFSI aquimarina 171 LDDGRKVTFKLLAADTAKDNRKDNDADRRFVLV-EQHTRIKYDDEGLDYEDEVLPIVVDS 229 pok IDNELVCLFEYVSFPTTTKQSALNTKALDFIVGSNLIS TEWKDELLTLAPTEKDNKRT 296 HA QNNELTILFEYATLPKGSKQETLNIESYNKIVSAKVLTTDWLNDLAQPAPTEKEPKRT 296 MTCC QNNELTILFEYATLPKGSKQETLNIESYNKIVSAEVLTTDWLNDLAQPAPTEKEPKRT 296 aquimarina 230 SGEQDELVIQFEYKVVKKGTKQEALVSQALDAILSNSNIQSDWV-DVTKREPTEKNPNRT 288 pok1 297 ELQKHLDIYTQKNTADYFIHKDLGKFLRHELDFYIKNEVMHLDNVISSDDFTQIERQLTI 356 HA 297 VLQKHLSTYTQKNTADYFIHKDLGKFLRHELDFYIKNEVMHLDDVVSTDQFIQIERQLSI 356 MTCC 297 VLHKHLSTYTQKNTADYFIHKDLGKFLRHELDFYIKNEVMHLDDVVSTDQFIQIERQLSI 356 aquimarina 289 LLEKHLTTYTQRNTADYFIHKDLGGFLSNELDFYIKNEVMNLDNVQNAEVFSDIEKQLRM 348 pok1 357 IKCLRQVGLEIIDFLASLEDFQKKLWLKKKFVVSSHYCITLDRIDENFYPAIVANDKQWN 416 HA 357 IKCLRQIGLEIISFLASLEDFQKKLWLKKKFVVSAEYCITLDRVDESLYAEIAENTAQWQ 416 MTCC 357 IKCLRQIGLEIISFLASLEDFQKKLWLKKKFVVSAEYCITLDRVDDSLYAEIAENTSQWQ 416 aquimarina 349 IQCLRSISKDIVSFLAQLENFQKKLWEKIKFSWGVNYYISLCKIDTLTLSQLDISEQQIQ 408 pok1 417 EWESLGFKEKTPNWQTLEYLQAHPYMMVNTALFDLLFKSKLLNSIEDIDEQTNGLIIHSD 476 HA 417 QWEDLGFKGTDAGWGTADYLKQHQALMVDTSLFSLEFKVELLKRIDDLDAQTDG LIIHSD 476 MTCC 417 QWEDLGFKGTDAGWGTIDYLKQHQALMVDTSLFSIEFKARLLKTIDDLDAQTDGLIIHSD 476 aquimarina 409 EWKFLYDLDLESQISITSLADAFPNLMLNTEFMSIESRLKVLSVIEGLDDQLTGTV INSD

53 pok1 477 NFQAISLLENKYKNNIDTVYIDPPYNAKTSEILYKNTFKHASWLSFMDSRLEKTLPLLAK 536 HA 477 NFQALNLIKDKYDSNIQSIYIDPPYNTNASEIIYKNGFKHSSWLSLLDSRFDLTKKLMNK 536 MTCC 477 NFQALRLIEKKYNNTVQSIYIDPPYNTSASEILYKNSFKHSSWATLIENRIEESTSLLKK 536 aquimarina 469 NFQGLQFLKSRYNDKIDCIYIDPPYNATSSEILYKNNFKHSAWLSFIESRLIVAKKLMHP 528 pok1 537 RSAMCIAIDENEQEYLGMLLGNAYPQYRKHCVALV-HNKKGIQG-KDFSYCHEYAYFLLS 594 HA 537 DSLICVTIDDVEKDKLKMLMDYSFGYENSMGTIVIRNNPSGRSTTKGVSIAHEYGLLYSK 598 MTCC 537 QGLLCVTIDDLELYNLKMILDQQFGAENFLANVLIRNNPSGRSTLKGFSVNHEYGLFYSK 598 aquimarina 529 EATIIIAIDENEQERLGLLIDNLFPNHDKFCISII-HNPAGVQG-INFSSSHEYAYFVFP 586 pok1 595 EDHMG SNDYILPE--KDWEWSNLRKWGSESTRDTAANCFYPIFIK-D-D 639 HA 597 SE-SAVVGRLPRNEKQDSRYKEVDEVGKFEWVNFRKHGGM--KSDAPSMYYPIFIS-G-D 651 MTCC 597 GELENGVGRLPHDEAQRSRYSLKDNKGFFEWENLRRNGPDSRKEDRPKQYYPIKYNKVEK 656 aquimarina 587 KG-GNYIGQTEREEPL ISNFRDWGGTSARKLAKTCFYPIKVK-D-N 629 pok1 640 RIIGFGDVCPNDFHPES-NNIE-CGDGS-IAVYPIDQSGIERKWRYERGTVEGILSLLRV 696 HA 652 TL-RIPDMEFNEISKEWLL-KEEPRGNE-VVIYPIDEHGLDRRWKWGIDRFKNELKNCKV 708 MTCC 657 SI-ALLPMEWDERKKTWSHSINSINENE-IILWPHHPKGELKVWRYSKEHIENEPERFQV 714 aquimarina 630 KIVGFGDVCDEDFHPIS-SN---VQDGEITLVYPIDSKGVERKWVFSKSTAERDSDQLFV 685 pok1 697 NRSK-NELQIQKAKND----LKFKTIWDKNTYIAGDYGTRIVTDIGINTGNNLFPKSIYT 751 HA 709 SNDKSGKKAVYIKARMNEEGVLPMTWWDQKEYSATAYGTNLLKTFFKSLDSFSYPKALNA 768 MTCC 715 IEKD-GLFEVYRKKYINSEGILPRTWWEKPGYSARDNGTRALIEFFGQVAQFDFPKAKDA 773 aquimarina 686 VEDK-GEISIKRKKTT----RSHRTVWDSKKYYANIYGSKVITSMFGE-QPFSFPKSIHT 739 pok1 752 VKDSIYAISQ---MNDTVLDYFGGSGTTAHATIELNREDNGNRKYILVEQGEYFDTVIKP 808 HA 769 VKDMLKVLSNK-NSNDIVLDYFGGSGTTAHATIALNREDHGNRKYILVEQGEYFDTVIKP 827 MTCC 774 VKDCFKVLK-L-NSKDIALDYFGGSGTSAHAVIDLNREDKGTRKYILMEQGEYFNTVLKP 831 aquimarina 740 VEDCLKALSRFRKKNGIVMDFFAGSGTTGHAAINLNRQDGGTRKFILVEQGDYCKKVTIP 799 pok1 809 RIQKVVYSKDWKDGKPINTDTGIS HCLKVMKLESYEDTLNNLELKRSGDQERLFNGLKD- 867 HA 828 RIQKVIY SADWKEGKPTNPESGISHCLKVVKLESYEDTLNNLELVRKGTQQTLLAEQQTS 887 MTCC 832 RIQKVVYSADWKGGKP TNPESGISHCLKVVKLESYEDTLNNLELVRKGAQQTLLAEQQTS 891 aquimarina 800 RVLKAMY SSRWKSGSPELNDS-ISGIVKVLSIESYEDSLNNLELRKSQATGDLFDSMPE- 857 pok KQKDDYLMHYMLNIESKGSLLSINDFRKPFDYQMNITTDSAGAYEKQKVDLVET 921 HA 888 AKPEDQNAYSDYLMHYMLELESKDSLLNVKDFLKPFSYQMNITTDSAGAFERKNIDLVET 947 MTCC 892 TKPEDQNAYSDYLMHYMLELESKDSLLNVKDFLKPFSYQMNITTDSAGAFERKNIDLVET 951 aquimarina QAKSDYLLNYMLETESKGSLLSTDDFKKPFDYKMKIAVDSAGAFEERNIDLVET 911 pok1 922 FNYLIGLEVQYIDSQLERGYIQVTGKLRNGDKATILWRDCEKIGYEELTELLDKKLKISA 981 HA 948 FNYLIGMNVQEVDYQLDKGYAQITGKLRTGEYTTVLWRDCEKIGYAELDQLLS-KLKINP 1006 MTCC 952 FNYLIGMNVREADYQLDKGYVQITGQLRTGEYTTVLWRDCDKIGYAELDQLLA-KLKINP 1010 aquimarina 912 FNYLVGLHVNTVESNIERGYVRVEGNLPSGEKALILWRDCEKIGYDDFTKFAN-RFDLFA

54 pok1 982 SDSEYDVIYINGDHTINNRLITDGEQGGKNLKIRSVEQEFLTRMFE---GE 1029 HA 1007 NDGEYQLIYINGDHNVASKYTTKEGE-EKQLKVRSIEQTFLKNMFE----E 1052 MTCC 1011 NDGEYQLIYINGDHNVASKYTTKEGE-EKQLKVRSIEQTFLKNMFE----E 1056 aquimarina 971 KEKTFDVIYVNGDHNLPTAFTSDEGEVTRTLKLRQIEPEFLELMFAPDELA 1021 Fig. 18. Porównanie sekwencji aminokwasowych metylotransferazy Orf5 pok1 i białek pokrewnych. Sekwencje porównywane z metylotransferazą pok1 (pok1) pochodzą kolejno z Acinetobacter sp. HA (GenBank: WP_ ) (HA), Acinetobacter junii (GenBank: EPR ) (MTCC) oraz Kangiella aquaimarina (GenBank: WP_ ) (aimarina). Na niebiesko zaznaczono aminokwasy identyczne we wszystkich sekwencjach, na szaro identyczne w trzech z nich. Obramowaniem zaznaczono domenę charakterystyczną dla adenino specyficznych metylotransferaz DNA Mod. Rzymskimi cyframi zaznaczono sekwencje motywów charakterystycznych dla metylotransferaz. Żółta czcionka oznacza silnie konserwowane w motywie aminokwasy. Kolorowymi ramkami zaznaczono przewidywaną strukturę drugorzędowa zidentyfikowanej metylotransferazy. Sekwencje rozpoznawane przez metylotransferazy typu III są asymetryczne. Podjednostka układu odpowiadająca z specyficzność metylotransferaza Mod jest stale aktywna, natomiast podjednostka odpowiedzialna za aktywność endonukleolityczną Res jest aktywna tylko w kompleksie z Mod, aktywność restrykcyjna jest stymulowana przez S- adenozylometioninę (AdoMet). Wykorzystując program Conserved Domains Search zlokalizowano w Orf5 pok1 domenę charakterystyczną dla adenino-specyficznych metylotransferaz DNA Mod (COG2189). W jej obrębie wyróżniono dwa fragmenty domeny charakterystycznej dla rodziny N-4/N-6 metylotransferaz (Pfam: PF01555). Jest to rodzina, do której należą metylotransferazy DNA N-4 cytozyno-specyficzne oraz N-6 adenino-specyficzne. Metylotransferazy N-6 adenino-specyficzna to enzymy, które przenoszą grupę metylową na grupę aminową w pozycji C-6 adeniny w nici DNA. Są to enzymy znajdowane w trzech istniejących typach bakteryjnych systemów R-M (w typie III metylotransferaza jest produktem genu mod). Enzymy te zawierają w N-końcowej części konserwowany motyw Asp/Asn-Pro-Pro- Tyr/Phe, który może brać udział w wiązaniu substratu lub determinować aktywność katalityczną (Timinskas i wsp., 1995). AdoMet-zależne metylotransferazy mają konserwowaną domenę katalityczną, o czym świadczy obecność we wszystkich grupach charakterystycznych motywów (Malone i wsp., 1995). Motywy te zostały również zidentyfikowane w opisywanej sekwencji pochodzącej z plazmidu pok1 (Fig. 18). Funkcja poszczególnych motywów nie została sprecyzowana, wiadomo jednak, że motywy I, III i X odpowiadają za wiązanie AdoMet, a motywy IV, VI i VIII są zaangażowane w aktywność katalityczną, dzięki tworzeniu aktywnej struktury z motywami V i VII (Schluckebier i wsp., 1995). Otwarte ramki odczytu oznaczone jako orf06 i orf07 kodują potencjalną endonukleazę restrykcyjną (odpowiednio jego N- i C- końcową część). Wyróżnione ORF nachodzą na siebie (ponad 90 pz), zaś w obszarze wspólnym prawdopodobnie dochodzi do programowanej zmiany 54

55 ramki odczytu, co mogłoby prowadzić do powstania białka fuzyjnego. Alternatywnie gen ten został zmutowany poprzez wprowadzenie mutacji, która zmieniła jego ramkę odczytu. Potencjalne białko Orf6 wykazuje podobieństwo sekwencji (na poziomie 53-70%) do endonukleaz restrykcyjnych typu III, pochodzących z różnych szczepów. Orf06 wykazuje podobieństwo sekwencji do endonukleazy restrykcyjnej E. coli DEC1C (GenBank: EHU ). Enzym E. coli ma długości 991aa, a podobieństwo Orf6 obejmuje aminokwasy od 1 do 787. Z kolei Orf07 wykazuje podobieństwo do tego samego białka E. coli - od 785 aminokwasu do końca polipeptydu. Na Fig. 19 i Fig. 20 przedstawiono porównanie sekwencji aa wyróżnionych składowych systemu R-M pok1 oraz białek pokrewnych. pok1 1 MAKKPIA----KKSKAVKVSFHNQLILTKWLWSHLNPSMLEKMRDQLDKPDYEGIETTGD 56 DEC1C 1 MAKKPTTGKAVKKETNSKLSFHKQLVLNRFMFHFFKDGTLQGLKNRLGEDRFEGIHED-- 58 HA 1 MAKAPKA----K-TKAVKVNFHEQLILNKWLWSKFNPNRLEGMKQQLDHPQFEGIEHEGD 55 baumannii 1 MAKAPKA----K-TKALKVNFHEQLILNKWLWSKFNPNRLEGMKQQLDHQQFEGIEHEGD 55 pok1 57 NIGQTKFFTVLTSSLFNKHLIDSDTLRRYDLNIAQYWQQITEQRNEKEGHILNLKYFQYL 116 DEC1C 59 --GQSLFFHELSNYLFEVDLIDLDELRRYDLNIVQHWQQITEHRNRKEDTVLNMKYFQYL 116 HA 56 NTGQTKFFSVISNTLFNKQVIDIDVLRRYDLNIVKHWQKITEKRNEIEGHVLNLKYFQYL 115 baumannii 56 NAGQTKFFSVISNTLFNKQVVDIDVLRRYDLNIVKHWQKITEKRNEIEGHVLNLKYFQYL 115 pok1 117 SLLFTEIYLDHYFNR QSEMIDALDIEIDKYNESQ----K-ELDTFQSYIAEDLNKVSFWN 171 DEC1C 117 SLLFTEIYLDWYFNRKQQLLDGLNNELAAYNAENDK TAKDRANQFKSYVLDDLNKLAYWN 176 HA 116 SLLFTELYLDQYF NHQADMLNELNVELEQYNDDQ----KIDADQFQQYLPEDLNKIGYWN 171 baumannii 116 SLLFTELYLDQYF HHQADMLNELNVELEQYNDDQ----KIDADQFQQYLPEDLNKIGYWN 171 pok1 172 ATGSGKTLLMHVNILQYLHYFHQKYGVDKNPDQIILLTPNEGLSHQHFHDFELSGI-SAT 230 DEC1C 177 ATGSGKTLLLHVNILQYLHYFQNGN-SHHYPDKIILLTPDERLSKQHLDELENSGFTQYQ 235 HA 172 ATGSGKTLLMHVNILQYLDYFQHQNGDSTYPDQIILLTPNEGLSEQHLQELTDSGF-QAT 230 baumannii 172 ATGSGKTLLMHVNILQYLDYFQHQNGDSTYPDQIILLTPNEGLSEQHLQELTDSGF-QAT 230 pok1 231 IFDKNRSRDSLLKDEIQIIDINKLSDRDGDKTVATSSLEGQNLVLIDEGHRGTS-SAGIW 289 DEC1C 236 LFDKSKS--APFKGTIEVIDINKLDDKMGDKTVAVEAFEGNNLVLIDEGHKGTGSAAGAW 293 HA 231 LFDKQKSRNSLYRDEIQIIDMNKLSDTDGDKTVATMSLEGKNLVLIDEGHRGTSSTAGAW 290 baumannii 231 LFDKQKSRNSLYRDEIQIIDMNKLSDTDGDKTVATMSLEGRNLVLIDEGHRGTSSSAGAW 290 pok1 290 MERRDILTRNGFSFEYSAT FGQAVNKASNVHKSYEDAKKAKSKMLYNTTALKNLTEEQVS 349 DEC1C 294 MRRRDKLTRDGFAFEYSAT FGQAVAGGNNVEAVETEIQKKKAKLLFETTALGKLSEEELA 353 HA 291 MERRDILTKDGFSFEYSAT FGQAVSKADNVYKRFEDAKKQKAKMLYG-VAINKLTEEQKK 349 baumannii 291 MERRDILTKDGFSFEYSAT FGQAVSKADNVYKRFEDAKKQKAKMLYG-MAINKLTEEQKK 349 pok1 350 AIQLDDLEKLKCRREALREAYAKNILFDYSYKYFYQDGYGKEVNILNMKEY--SEEQDRD 407 DEC1C 354 QIALTSEEQRDARIQATREVYGKSILFDYSYKFFYEDGYGKESLILNLNPQDDKKDERRY 413 HA 350 NIQLDDLEQQKYRREALREVYAKSILFDYSYKYFYADGYGKEVNILNMKEY--HEDDERN

56 baumannii 350 NIQLDELEQQKYRREALREVYAKSILFDYSYKYFYADGYGKEVNILNMKEY--HEDDERN 407 pok1 408 LYLTACLLAFYQQQYLFKKNEERLVQFNIENPLWVFVGNKVNDDDSDILTIIQFLSRFLD 467 DEC1C 414 EYFTACLLSFYQQQYLFNKNKEKLNEFNIEKPLWVFVGNSVSGEDSDIHAVLRFLAWFLN 473 HA 408 LYLTACLLSFYQQQYLFKKNQVKLAKFNIEKPLWVFVGNKVNDDDSDILAIVKFLADFLD 467 baumannii 408 LYLTACLLSFYQQQYLFKKNQAKLAKFNIEKPLWVFVGNKVNDDDSDILAIVKFLADFLD 467 pok1 468 PQYKAQNIEWLQDLVTNKSRLVDNSGVNIFTNRFAALHGQVASKLYEDILLRFFNAS-TN 526 DEC1C 474 HETQAK--AWINDLIKNKARILDTKERNIFENRFTALMNA-PEDIYADILSRLFNTTHSG 530 HA 468 ASRKSKVISWLHDLITNTSRLVDPKGNNIFANRFAPLYGQNATELYQDILKSFFNAT-TN 526 baumannii 468 ASRKSKVISWLHDLITNTSRLVDPKGNNIFANRFAPLHGQNATDLYQDILKSFFNAT-TN 526 pok1 527 QRLNVVRVAANTGELKLQVGENNPFALINVGDEAGLYKLCETLSLDNYFDVRNDDFSPSL 586 DEC1C 531 QRLRVLNLIGSKGELALQVGEAEPFGLINIGDAPSLYKMCEEDTT---FDYQRDDFAKSL 587 HA 527 QRLNVVRITANKGELRLQVGENTPFAVINVGDEKGLYDNCENSSQTHYINARTDDFAESL 586 baumannii 527 QRLNVVRITANKGELRLQVGENTPFAVINVGDEKGLYDNCDESSKTHYLNARTDDFAESL 586 pok1 587 FGTLNNKDCSINLLIGSKKFTEGWSSWRVSTMGLLNMGTGEGSQIIQLFGRGVRLKGEDF 646 DEC1C 588 FHTLNDKDSRLHILIGSRKFTEGWSSWRVSTMGLLNMGRGEGSQIIQLFGRGVRLKGRNY 647 HA 587 FPTLNNDDSETHLLIGSRKFTEGWSSWRVSTMGLLNMGSGEGAQIIQLFGRGVRLKGENF 646 baumannii 587 FPTLNNDDSETHLLIGSRKFTEGWSSWRVSTMGLLNMGSGEGAQIIQLFGRGVRLKGENF 646 pok1 647 SLKRT-PREIYTQANYKDLYLDFLQTLNIFGLKANYMEAFREYLNDEGIVLNQDLVTLDF 705 DEC1C 648 SLKRSTPGE-----RPKGLHLEKLETLNVFGVRADYMATFKQYLEDEGITPSDEILELNF 702 HA 647 SLKRT-PREIYSKAEYKGLHLDLMQTINIFGLRADYMEKFRDYLNDEGIILNQDLVTLDF 705 baumannii 647 SLKRT-PREIYSKAEFKGLHLDLMQTINIFGLRADYMEKFRDYLNDEGIILNQDLVTLDF 705 pok1 706 KTNTIKPSTKLKTLVLKDGYKDNQANGFKAKIKPWVFTQVLDLDWLRQSENSANLEKKIK 765 DEC1C 703 ETRPNMPATRLKTLKLKDGYKDNQRLGFKRVYFPELYE VPADFQGKIK 750 HA 706 PTNKIQ-APRLKTLTLKDGYKDNQANGFKAQLKLSMFK IPKQYEGKIK 752 baumannii 706 PTNKIQ-APRLKTLTLKDGYKDNQANGFKAQLKLSMFK IPKQYEGKIK 752 pok1 766 KPFVVLDLYPRLQSFHTDRSKEIIE-QDKRQNNIISQDLMCFLI DEC1C 751 QPHIKLDLYPKLESIDTSRKGENTP-VNVRNEAKLDYKIISAFDFDRLYLAIQNYKLQRG 809 HA 753 KPFVVLDLYPRLQAFHTDKSKRQMDVKDKRQEHEISPKIMCMFDFDEIYLQLQQYKFQRG 812 baumannii 753 KPFVVLDLYPRLQAFHTDKSKRQTDVKDKRQEHEISPKIMCMFDFDEIYLQLQQYKFQRG 812 pok DEC1C 810 WSNLRVDKQRLIDFCTGKTKIG-NSWYTLLIPASELEIKQYADIAKQEDIMLRLLTDYTD 868 HA 813 YSNLQLNVDDLQEFCLRNIKSSTEDWYKLLVDGSELS-NDVGGIKKQQAILTELLQSYMD 871 baumannii 813 YSNLQLNVDDLQEFCFRDIKSSTEDWYKLLVDSSELT-NDVSGIKKQQAILTELLQSYMD 871 pok DEC1C 869 RFYNTLKNAYEGQFYEVTQVKEDDPGM----IKMYHFEIEET--DDGLAYASRLEQLQQL 922 HA 872 KFYHAIKNAYEGQFYEVTEFSLDDKDLPVQICEQYTLTAKDGQNNEAQEVFDRLETLKDL 931 baumannii 872 KFYHAIKNAYEGQFYEVTEFSLDDKDLPVQICEQYTLTAKDGQNNEAQEVFDRLETLKDL 931 pok DEC1C 923 VIDGEIGKAKSWSASGM-VAITFDKHLYYPLLSIEKNANIPLKMRPAAL-----GASSEI 976 HA 932 VAKGDVEKLAPWKEDGSFRAITFDRHLFYPLLD-KKDESLPFTWSPMLFDYTSHTQSSEV 990 baumannii 932 VAKGDVEKLAPWKEDGSFRAITFDRHLFYPLLD-KKDESLPFTWSPMLFDYTSHTQSSEV 990 pok DEC1C 977 TFVHDLQSFVDST

57 HA 991 KFVLDLQSYINTPAADDLLKDYELYLLRNADNKYRGLGFALAGNFYPDFLLWLVNKQTGQ 1050 baumannii 991 KFVLDLQSYINTPDADALLKGYELYLLRNADNKYRGLGFALAGNFYPDFLLWLVNKQTGQ 1050 pok LMQFIWSCCST DEC1C HA 1051 QYLTLVDPKGIRNMNHDDAKIELYKEIKNIEAKLEHPDLILSSFILSITPMKDILNNSLS 1110 baumannii 1051 QYLTLVDPKGIRNMNHDDAKIELYKEIKNIEAKLEHPDLILSSFILSITPMKDILNNSLS 1110 pok RHREVIAI 827 DEC1C KG 991 HA 1111 EEEFAEKNVLFMVGNGTAYLGKMLEKILQL 1140 baumannii 1111 EEEFAEKNVLFMVGNGTAYLEKMLEKILQP 1140 Fig. 19. Porównanie sekwencji aminokwasowych endonukleazy Orf06 i białek pokrewnych. Sekwencje porównywane z potencjalną endonukleazą pok1 (pok1) pochodzą kolejno z E. coli DEC1C (GenBank: EHU ) (DEC1C), Acinetobacter sp. HA (GenBank: WP_ ) (HA) oraz Acinetobacter baumannii (GenBank: WP_ ) (baumanii). Na niebiesko zaznaczono aminokwasy identyczne we wszystkich sekwencjach, na szaro identyczne w trzech z nich. Obramowaniem zaznaczono aminokwasy tworzące domenę charakterystyczną dla podjednostki res enzymów restrykcyjnych typu III. Czerwoną czcionką zaznaczono aminokwasy zaangażowane w wiązanie ATP, żółtą wiążące jony wapnia. pok1 1 Y DEC2A HA 1 MAKAPKAKTKAVKVNFHEQLILNKWLWSKFNPNRLEGMKQQLDHPQFEGIEHEGDNTGQT 60 baumannii 1 MAKAPKAKTKALKVNFHEQLILNKWLWSKFNPNRLEGMKQQLDHQQFEGIEHEGDNAGQT 60 pok DEC2A HA 61 KFFSVISNTLFNKQVIDIDVLRRYDLNIVKHWQKITEKRNEIEGHVLNLKYFQYLSLLFT 120 baumannii 61 KFFSVISNTLFNKQVVDIDVLRRYDLNIVKHWQKITEKRNEIEGHVLNLKYFQYLSLLFT 120 pok DEC2A HA 121 ELYLDQYFNHQADMLNELNVELEQYNDDQKIDADQFQQYLPEDLNKIGYWNATGSGKTLL 180 baumannii 121 ELYLDQYFHHQADMLNELNVELEQYNDDQKIDADQFQQYLPEDLNKIGYWNATGSGKTLL 180 pok DEC2A HA 181 MHVNILQYLDYFQHQNGDSTYPDQIILLTPNEGLSEQHLQELTDSGFQATLFDKQKSRNS 240 baumannii 181 MHVNILQYLDYFQHQNGDSTYPDQIILLTPNEGLSEQHLQELTDSGFQATLFDKQKSRNS 240 pok DEC2A HA 241 LYRDEIQIIDMNKLSDTDGDKTVATMSLEGKNLVLIDEGHRGTSSTAGAWMERRDILTKD 300 baumannii 241 LYRDEIQIIDMNKLSDTDGDKTVATMSLEGRNLVLIDEGHRGTSSSAGAWMERRDILTKD 300 pok DEC2A HA 301 GFSFEYSATFGQAVSKADNVYKRFEDAKKQKAKMLYGVAINKLTEEQKKNIQLDDLEQQK 360 baumannii 301 GFSFEYSATFGQAVSKADNVYKRFEDAKKQKAKMLYGMAINKLTEEQKKNIQLDELEQQK 360 pok DEC2A HA 361 YRREALREVYAKSILFDYSYKYFYADGYGKEVNILNMKEYHEDDERNLYLTACLLSFYQQ 420 baumannii 361 YRREALREVYAKSILFDYSYKYFYADGYGKEVNILNMKEYHEDDERNLYLTACLLSFYQQ 420 pok NF

58 DEC2A MRFLAWFLNHETQAK--AWIND 20 HA 421 QYLFKKNQVKLAKFNIEKPLWVFVGNKVNDDDSDILAIVKFLADFLDASRKSKVISWLHD 420 baumannii 421 QYLFKKNQAKLAKFNIEKPLWVFVGNKVNDDDSDILAIVKFLADFLDASRKSKVISWLHD 420 pok DEC2A 21 LIKNKARILDTKERNIFENRFTALMNA-PEDIYADILSRLFNTTHSGQRLRVLNLIGSKG 79 HA 481 LITNTSRLVDPKGNNIFANRFAPLYGQNATELYQDILKSFFNAT-TNQRLNVVRITANKG 539 baumannii 481 LITNTSRLVDPKGNNIFANRFAPLHGQNATDLYQDILKSFFNAT-TNQRLNVVRITANKG 539 pok S DEC2A 80 ELALQVGEAEPFGLINIGDAPSLYKMCEEDTTFDY---QRDDFAKSLFHTLNDKDSRLHI 136 HA 540 ELRLQVGENTPFAVINVGDEKGLYDNCENSSQTHYINARTDDFAESLFPTLNNDDSETHL 599 baumannii 540 ELRLQVGENTPFAVINVGDEKGLYDNCDESSKTHYLNARTDDFAESLFPTLNNDDSETHL 599 pok DEC2A 137 LIGSRKFTEGWSSWRVSTMGLLNMGRGEGSQIIQLFGRGVRLKGRNYSLKRSTPGE HA 600 LIGSRKFTEGWSSWRVSTMGLLNMGSGEGAQIIQLFGRGVRLKGENFSLKRT-PREIYSK 658 baumannii 600 LIGSRKFTEGWSSWRVSTMGLLNMGSGEGAQIIQLFGRGVRLKGENFSLKRT-PREIYSK 658 pok DEC2A 193 RPKGLHLEKLETLNVFGVRADYMATFKQYLEDEGITPSDEILELNFETRPNMPATRLKT 251 HA 659 AEYKGLHLDLMQTINIFGLRADYMEKFRDYLNDEGIILNQDLVTLDFPTN-KIQAPRLKT 717 baumannii 659 AEFKGLHLDLMQTINIFGLRADYMEKFRDYLNDEGIILNQDLVTLDFPTN-KIQAPRLKT 717 pok DEC2A 252 LKLKDGYKDNQRLGFKRVYFPELYEVPADFQGKIKQPHIKLDLYPKLESIDTSRKGENTP 311 HA 718 LTLKDGYKDNQANGFKAQLKLSMFKIPKQYEGKIKKPFVVLDLYPRLQAFHTDKSKRQMD 777 baumannii 718 LTLKDGYKDNQANGFKAQLKLSMFKIPKQYEGKIKKPFVVLDLYPRLQAFHTDKSKRQTD 777 pok RFDVFFDFDAIYLELLQYKAQRGYSNLKITQDNIVDFCCNK---DPND 49 DEC2A 312 V-NVRNEAKLDYKIISAFDFDRLYLAIQNYKLQRGWSNLRVDKQRLIDFCTGKTK-IGNS 369 HA 778 VKDKRQEHEISPKIMCMFDFDEIYLQLQQYKFQRGYSNLQLNVDDLQEFCLRNIKSSTED 837 baumannii 778 VKDKRQEHEISPKIMCMFDFDEIYLQLQQYKFQRGYSNLQLNVDDLQEFCFRDIKSSTED 837 pok1 50 WYKLLIDRSELM-NTVAGIIKQQWILIELLKAYMDKIYSTFKNAYEGQYYTVQEFDLANS 108 DEC2A 370 WYTLLIPASELEIKQYADIAKQEDIMLRLLTDYTDRFYNTLKNAYEGQFYEVTQVKEDDP 429 HA 838 WYKLLVDGSELS-NDVGGIKKQQAILTELLQSYMDKFYHAIKNAYEGQFYEVTEFSLDDK 896 baumannii 838 WYKLLVDSSELT-NDVSGIKKQQAILTELLQSYMDKFYHAIKNAYEGQFYEVTEFSLDDK 896 pok1 109 MLDDLPIDICQQYTLTAKEDQNSEASDYFERIKNLQALVENGTVDELAPWQQDGSFRAIT 168 DEC2A G----MIKMYHFEIEETD--DGLAYASRLEQLQQLVIDGEIGKAKSWSASGM-VAIT 479 HA DLPVQICEQYTLTAKDGQNNEAQEVFDRLETLKDLVAKGDVEKLAPWKEDGSFRAIT 953 baumannii DLPVQICEQYTLTAKDGQNNEAQEVFDRLETLKDLVAKGDVEKLAPWKEDGSFRAIT 953 pok1 169 FDRHLYYPLFD-KTDDNLPFTWSPALFDYSKNGQSSEVQFVTDLQEYVNSDIGKEILDGY 227 DEC2A 480 FDKHLYYPLLSIEKNANIPLKMRPAAL-----GASSEITFVHDLQSFVDSTKGQKIIGDK 534 HA 954 FDRHLFYPLLD-KKDESLPFTWSPMLFDYTSHTQSSEVKFVLDLQSYINTPAADDLLKDY 1012 baumannii 954 FDRHLFYPLLD-KKDESLPFTWSPMLFDYTSHTQSSEVKFVLDLQSYINTPDADALLKGY 1012 pok1 228 QLYLFRNPDNKYRGLGFALAGNFYPDFLMWLVHKESGKQFLTLVDPKGIRNMDSDDAKIE 287 DEC2A 535 SLYLLRNADSKNRGLGFATAGNFYPDFLLWLVDDKSGKQWLSLIDPKGIRNLNLDDPKFG 594 HA 1013 ELYLLRNADNKYRGLGFALAGNFYPDFLLWLVNKQTGQQYLTLVDPKGIRNMNHDDAKIE 1072 baumannii 1013 ELYLLRNADNKYRGLGFALAGNFYPDFLLWLVNKQTGQQYLTLVDPKGIRNMNHDDAKIE 1072 pok1 288 FYKEIKIIESDIADEKLILNSFILSITSIQDLINCKLTEKEFVDKNVLFMNKGKAYYLGQ 347 DEC2A 595 LYKEIKNLEHKLSDDNLSLSAFIVSETCYVDLVNVPDSKENLEARNVLFIEDTGPLYLEK 654 HA 1073 LYKEIKNIEAKLEHPDLILSSFILSITPMKDILNNSLSEEEFAEKNVLFMVGNGTAYLGK 1132 baumannii 1073 LYKEIKNIEAKLEHPDLILSSFILSITPMKDILNNSLSEEEFAEKNVLFMVGNGTAYLEK

59 pok1 348 MFQRILFA 355 DEC2A 655 LFSKMVSE 662 HA 1133 MLEKILQL 1140 baumannii 1133 MLEKILQP 1140 Fig. 20. Porównanie sekwencji aminokwasowychj endonukleazy Orf07 i białek pokrewnych. Sekwencje porównywane z potencjalną endonukleazą Orf7 (pok1) pochodzą kolejno z E. coli DEC2A (GenBank: EHU ) (DEC2A), Acinetobacter sp. HA (GenBank: WP_ ) (HA) oraz Acinetobacter baumannii (GenBank: WP_ ) (baumanii). Na niebiesko zaznaczono aminokwasy identyczne we wszystkich sekwencjach, na szaro identyczne w trzech z nich. Dzięki aplikacji Conserved Domain Search i analizie w bazie Pfam w sekwencji Orf06 zlokalizowano domenę charakterystyczną dla podjednostki Res endonukleaz restrykcyjnych typu III (rodzina resiii, Pfam: PF04851). Baza CDD opisuje tę domenę jako typową dla rodziny helikaz DEAD (cd00046). Do tej rodziny należą różnego typu białka zaangażowane w ATPzależne rozwijanie DNA lub RNA. Domena ta zawiera region odpowiedzialny za wiązanie ATP (zaznaczony na Fig. 19). Zlokalizowano również region białka prawdopodobnie zaangażowany w wiązanie jonów wapnia. W sekwencji Orf07 możliwe było wyróżnienie jedynie domeny o nieznanej funkcji (Pfam: PF14302) Analiza potencjalnego systemu mobilizacji do transferu koniugacyjnego Potencjalny produkt białkowy kodowany przez orf25 prawdopodobnie jest zaangażowany w mobilizację plazmidu do transferu koniugacyjnego (MOB). Białko to wykazuje największe podobieństwo sekwencji (95% identyczności) do hipotetycznego białka Wohlfahrtiimonas chitiniclastica SH04, opisanego przez deponujących sekwencję jako endonukleaza VirD1. Pokrewne białka (36-47% identyczności) również zostały opisane w bazach danych jako składniki relaksosomu. Na Fig. 21 przedstawiono porównanie sekwencji aminokwasowych Orf25 i białek mu pokrewnych. Poszukiwanie konserwowanych domen wykazało obecność domeny charakterystycznej dla endonukleazy VirD1 (CDD: cl17530) lub bakteryjnych białek mobilizujących (MobC) (Pfam: PF05713). Domeny tego typu są zaangażowane w mobilizację plazmidu do transferu koniugacyjnego. Białko to prawdopodobnie bierze udział w nacięciu DNA w miejscu orit. Apisiridej i wsp. (1997) wykazali, że białka pokrewne MobC zawierają motyw sekwencji L/FxxxG/SxNxNQxAxxxN (znak x oznacza brak konserwowanego aminokwasu w danym miejscu). Motyw ten jest również obecny w wyróżnionej w sekwencji plazmidu pok1 (zaznaczony na Fig. 21). 59

60 pok1 1 LKK-QNRSIQVGIRFTEEEFAPYKSAAEKLGLSNAELLRAVLLNNFDPKIHDKKTRKDIK 59 ATCC 1 MTK-ENRSIPVSFRLTEREFAPYKLIMDEANISRTEFFRAIFLSKQY--TFTKNQKNEVG 57 Java 1 MRDSKGKSRVITLRLKEDEYARFEQILCDTGISKSDFFRLLILGKFDPNKHNKIAQNNHR 60 SH04 1 MKK-QNRSIQVGIRFTEEEFAPYKYAAEKLGLSNAELLRTVLLNNFNPKIHDRKTRKDIE 59 pok1 60 KLLFY FNKASNNINQLAKVIN TQAKTSNIDTKKLIQFYSKLNRIYDSFENGIEHAKKSSD 119 ATCC 58 KILFAFNKTSNNINQIAKRLNTDNKKGIISQRSYNLAINELISIQSQLQRLIE Java 61 KLLFYFNKASNNINQIAKRLNQDHRNGIVSETTYKRILNVLVNVRDTFSNGVD SH04 60 KLLFYFNKASNNINQLAKVINTQAKTSNIDTKKLIQFYSKLNRIYDSFENGIEHAKKSSD 119 pok1 120 PR ATCC 111 KC Java 114 KC SH PR Fig. 21. Porównanie sekwencji aminokwasowych Orf25 pok1 i białek pokrewnych. Sekwencje porównywane z sekwencją Orf25 (pok1) pochodzą kolejno z Vibrio ichthyoenteri ATCC (GenBank: EGU ) (ATCC), Yersinia pestis Java 9 (GenBank: YP_ ) (Java) oraz Wohlfahrtiimonas chitiniclastica SH04 (GenBank: ELV ) (SH04). Na niebiesko zaznaczono aminokwasy identyczne we wszystkich sekwencjach, na szaro identyczne w trzech z nich. Kolorowymi ramkami zaznaczono przewidywaną strukturę drugorzędowa zidentyfikowanego białka. Obramowaniem zaznaczono konserwowany motyw charakterystyczny dla białek MobC. Żółta czcionką zaznaczono konserwowane aminokwasy Inne elementy genetyczne zintegrowane z genomem plazmidu W analizowanej sekwencji wyróżniono kilka ruchomych elementów genetycznych zintegrowanych z genomem pok1. Są to elementy transpozycyjne (orf17-orf18, orf19, orf21, orf22, orf43, orf49) oraz kasety genowe integronu (orf39-orf41). W kolejnych podrozdziałach zamieszczono szczegółowy opis tych struktur Elementy transpozycyjne Elementy transpozycyjne (TE, ang. transposable elements) stanowią najliczniejszą grupę ruchomych elementów genetycznych. Są one zdolne do przemieszczania się z jednego miejsca genomu w inne (w obrębie jednego lub między różnymi replikonami) w wyniku transpozycji, czyli rekombinacji nieuprawnionej. Jest to proces katalizowany przez transpozazy (Tnpazy), enzymy kodowane w obrębie TE. Ze względu na stopień złożoności struktury genetycznej, wśród TE wyróżniamy: sekwencje inercyjne (IS, ang. insertion sequence) oraz transpozony (Tn). IS są najprostszymi TE, kodują bowiem jedynie informację genetyczną niezbędną do własnej transpozycji. Na ich końcach występują identyczne lub prawie identyczne odwrócone powtórzenia sekwencji (IR, ang. inverted repeats). Transpozony są to elementu większe, które mogą również zawierać geny determinujące fenotyp gospodarza. Wśród transpozonów 60

61 wyróżniamy transpozony złożone, posiadające na obu końcach IS, oraz transpozony niezłożone, nie zawierające terminalnie ułożonych IS. Otwarte ramki odczytu orf17 i orf18 pok1 kodują potencjalne białka wykazujące podobieństwo sekwencyjni (68%) do transpozazy Vibrio cholerae TM , odpowiednio do podjednostki A i B (GenBank: EEO , EEO ). Obydwa białka pok1 są krótsze niż te opisane w bazie danych. Sekwencje obu podjednostek wykazują podobieństwo do innych transpozaz występujących w bakteriach z rodzaju Vibrio, kodowanych przez elementy z rodziny IS3. Obie ORF pok1 zachodzą na siebie o 15pz, co może sugerować generowanie fuzyjnej Tnpzazy w wyniku programowanej zmiany ramki odczytu. Poszukiwanie konserwowanych domen białkowych w sekwencjach obu podjednostek (Pfam, Conserved Domains Serach) pozwoliło na zidentyfikowanie charakterystycznej domeny transpozaz. Podjednostka A zawiera domenę typową dla nadrodziny HTH_Tnp_1 (Pfam: PF01527), odpowiadającą za aktywność transpozazy i wiązanie z DNA. Pokrewne białka są kodowane przez wiele elementów insercyjnych oraz transpozaz, w tym przez IS grupy IS3 z rodziny IS3. Domena ta składa się z motywu HTH (na N-końcu) oraz zamka leucynowego. W obrębie podjednostki B znajduje się domena należąca do rodziny Rve (Pfam: PF00665). Jest to domena odpowiadająca za katalityczne właściwości integrazy. Pośredniczy ona w integracji DNA w miejscu docelowym. Analizy przeprowadzone w bazie danych ISfinder pozwoliły zaklasyfikować opisywaną IS do rodziny IS3. Analiza porównawcza wykazała, że Orf19 wykazuje najwyższe podobieństwo sekwencji (81% identyczność) z Tnpazą IS431mec, pochodzącą z Wohlfahrtiimonas chitiniclastica SH04 (GenBank: WP_ ). Sekwencja Orf19 jest krótsza od tej zdeponowanej w bazie o 93 aminokwasy. Może być to wynikiem wbudowania się w jej obrębie sekwencji insercyjnej, zawierającej orf17 i orf18 (Fig. 1). W sekwencji Orf19 zidentyfikowano domenę, typową dla transpozaz (COG3316). Do Tnpazy IS431mec najwyższe podobieństwo wykazują również orf43 i orf49 pok1 (identyczność sekwencji aa - 96%). Poszukiwanie konserwowanych domen (Conserved Domains Serach) pozwoliło wyróżnić w sekwencji obu ORF domenę transpozaz i inaktywowanych pochodnych (COG3316) oraz domenę Rve (opisaną wcześniej). Analiza porównawcza wykazała, ze opisywany element wykazuje największe podobieństwo do sekwencji insercyjnych należących do rodziny IS6. W sekwencji pok1 wyróżniono jeszcze jedną IS wykazującą podobieństwo do sekwencji pochodzącej z Wohlfahrtiimonas chitiniclastica SH04 (GenBank: ZP_ ). Element ten koduje transpozazę Orf22, wykazująca 55% identyczność sekwencji aa z Tnpazą IS

62 Transpozaza ta zawiera domenę Rve oraz domenę HTH_21 (Pfam: PF13276), odpowiadającą za oddziaływanie z DNA. W wyniku analiz porównawczych przeprowadzonych w bazie ISfinder, element niosący orf22 zakwalifikowano do grupy IS407 rodziny IS3. Kolejny TE pok1 zawiera orf21. Białko Orf21 wykazuje 70% podobieństwo sekwencji aa do transpozazy z grupy IS407 rodziny IS3, pochodzącej z Vibrio cholerae RC385 (GenBank: WP_ ). W wyróżnionej sekwencji obecna jest domena należąca do nadrodziny HTH_Tnp_1 (Pfam: PF01527). Ponieważ elementy wyróżnione w sekwencji plazmidu pok1 zostały zaklasyfikowane do rodzin IS3 i IS6, w tabeli 5 przedstawiono podstawowe informacje charakteryzujące te rodziny. Tabela 5. Podstawowe informacje o rodzinach IS3 i IS6 (ISfinder). rodzina podgrupa typowa wielkość (pz) generowane DR końce IR liczba ORF motyw katalityczny IS3 IS TG IS TG IS TG IS TGa/g IS TG obecne 2 motyw DDE IS GG obecne 1 motyw DDE DR, ang. direct repeats, proste powtórzenia sekwencji generowane w miejscu wbudowania elementu. IR, ang. inverted repeats, odwrócone powtórzone sekwencje obecne na końcach elementu. Kolumna końce określa nukleotydy konserwowane na końcu sekwencji. Duże litery oznaczają silnie konserwowane nukleotydy. Małe litery oddzielone ukośnikiem oznaczają możliwe zasady (ISfinder). W sekwencjach po obu stronach orf43 i orf49 zidentyfikowano jednakowe, 21- nukleotydowe odwrócone powtórzenia. Taka sama sekwencja została znaleziona również poniżej orf19. W tym przypadku brakuje drugiej sekwencji IR, podobnie i jak części genu transpozazy. Sekwencje te zostały prawdopodobnie zinaktywowane przez wbudowanie się elementu insercyjnego niosącego orf17-orf18. Obecność dwóch identycznych sekwencji insercyjnych (zaznaczonych na Fig. 22) stwarza możliwość przenoszenia zawartego między nimi fragmentu DNA, w postaci transpozonu złożonego. Możliwe jest również, że z pewną częstością może dochodzić do delecji fragmentu DNA pomiędzy tymi dwoma sekwencjami, w wyniku rekombinacji homologicznej. IS należące do rodziny IS6 zazwyczaj generują w miejscu integracji 8 nukleotydowe DR, które w genomie pok1 nie występują. Nie można jednak wykluczyć, że elementy pok1, podobnie jak ISS1W z Lactococcus lactis (Haandrikman, 1990), nie generują DR. 62

63 Fig. 22. Schemat organizacji potencjalnego nieautonomicznego transpozonu złożonego pok1. Na schemacie kolorowymi strzałkami zaznaczono ORF znajdujące się w obrębie potencjalnego transpozonu (IS sekwencja inercyjna, tetr koduje białko regulujące ekspresję genów oporności na tetracyklinę, teth nadająca komórce oporność na tetracyklinę, rep kodująca gen białka inicjującego replikację, TA system TA). Powiększono regiony, w których znajdują się odwrócone powtórzenia, oznaczone IR R i IR L (powtórzenie prawe i lewe). Na uwagę zasługuje fakt, że powtórzenie IR L sekwencji insercyjnej niosącej orf43, znajduje się w obszarze defektywnej ORF warunkującej oporność na czwartorzędowe związki amoniowe i bromek etydyny. W przypadku pozostałych sekwencji insercyjnych nie udało się wyznaczyć sekwencji IR ani sekwencji DR. Zarówno dla transpozaz sekwencji insercyjnych z rodzin z IS3, jak i IS6, w części aktywnej enzymu znajduje się motyw DDE. Jest to tak zwana katalityczna triada utworzona z trzech kwaśnych aminokwasów: dwóch asparaginianów i glutaminianu. Ich obecność warunkuje aktywność enzymatyczną transpozaz (Nesmelova i Hackett, 2010). Na Fig. 23 przedstawiono porównanie sekwencji konsensusowych motywów DDE z sekwencjami niektórych opisywanych transpozaz pok1. Motywy DDE transpozaz kodowanych przez pok1 są zbliżone do sekwencji konsensusowych. Warto zauważyć, że w przypadku wyróżnionych motywów skróceniu uległy sekwencje oddzielające aminokwasy tworzące katalityczną triadę. Różnice są szczególnie widoczne dla sekwencji oddzielających drugi asparaginian od glutaminianu (Fig. 23). Dla pozostałych potencjalnych transpozaz (Orf17-Orf18, Orf19, Orf21) nie udało się zidentyfikować motywów DDE. W przypadku Orf19 jest to wynikiem braku dużej części genu transpozazy. Z podobną sytuacją mamy do czynienia w przypadku transpozazy Orf21. Transpozazy te, choć prawdopodobnie defektywne, zawierają domeny odpowiedzialne za oddziaływanie z DNA. Brak motywu DDE powoduje, że transpozazy te są niezdolne do transpozycji. W przypadku transpozazy Orf17-Orf18, w sekwencji podjednostki B można wyróżnić jedynie fragment konserwowanej sekwencji motywu DDE, ale zlokalizowanie całego motywu nie jest możliwe. 63

64 Fig. 23. Porównanie sekwencji konsensusowych motywów DDE sekwencji insercyjnych należących do rodzin IS3 i IS6 z motywami DDE wyróżnionymi w sekwencjach insercyjnych wyróżnionych w plazmidzie pok1. Aminokwasy tworzące część konserwowanego motywu są przedstawione za pomocą dużych, pogrubionych liter. Wielkie litery oznaczają aminokwasy zachowane w rodzinie IS, a małe wskazują, że dany aminokwas jest dominujący. Liczby w nawiasach wskazują na liczbę aminokwasów znajdujących się pomiędzy konserwowanymi rejonami Integron Otwarte ramki odczytu orf38-orf42 stanowią elementy integronu opornościowego (Fig. 24). Integrony to elementy genetyczne zdolne do włączania kaset genowych w wyniku rekombinacji specyficznej wobec miejsca (ang. site specific recombination) (Wolinowska i wsp., 2002). Mobilne integrony zawierają kilka (do 9) kaset genowych, które warunkują oporność na wiele antybiotyków (Partridge i wsp., 2009). Istnieją też integrony zerowe, nie zawierające żadnej kasety. Włączanie kaset umożliwia integraza (Int), enzym kodowany w obrębie integronu. Na podstawie podobieństw sekwencji aminokwasowych integraz wyróżniono 5 grup tych elementów genetycznych. Białko Orf38 wykazuje największe podobieństwo sekwencji aa do integraz integronów klasy I (sekwencje te są niemal identyczne). Integrony klasy I charakteryzują się konserwowanym 5 końcem, kodującym integrazę, oraz 3 końcem zawierającym ORF kodujące: syntazę dihydropterynianową, defektywne białko warunkujące oporność na czwartorzędowe związki amoniowe (składnik środków dezynfekujących i antyseptycznych) i bromek etydyny (gen qacδe) (w genie tym obecna jest niewielka delecja, która powoduje, że kodowane białko nadaje komórce nieznaczną oporność, mimo że posiada własny promotor; Wolinowska i współaut. 2002) (Fig. 24). Przypuszcza się, że geny te pierwotnie stanowiły części kaset włączonych w strukturę integronu, które utraciły zdolność do mobilizacji poprzez utratę miejsca rekombinacji (Brown i wsp., 1996). 64

65 W przypadku integronu pok1, na końcu 3 występuje jedynie defektywny gen qacδe. Podobne struktury były już opisywane wcześniej (Brown i wsp., 1996). Region 3 nie jest niezbędny do funkcjonowania integronu. Poznano integrony klasy I pozbawione części lub całego tego regionu (Brown i wsp., 1996). orf26, poprzedzająca integron (Fig. 24), koduje syntazę dihydropterynianową. Gen ten nadaje komórce oporność na sulfonamidy poprzez syntezę enzymu mogącego zastąpić enzym, będący celem tej klasy leków. Otwarte ramki odczytu położone poniżej genu int kodują białka warunkujące odporność na: sulfonamidy (orf39), aminoglikozydy (orf40) i β-laktamy (orf41). Integrony zawierają zwykle dwa promotory - jeden odpowiedzialny za ekspresję genu integrazy - P int, oraz promotor odpowiedzialny za transkrypcję włączanych kaset genowych P c (Fig. 24). Za sprawą integrazy dochodzi rekombinacji pomiędzy miejscem integracji atti integronu i obszarem 59-be (ang. 59-base element) znajdującym się w kasecie genowej. Kaseta genowa w integronach klasy I jest specyficznie włączana między G i TT siedmionukleotydowej sekwencji, znajdującej się w tzw. miejscu prostym, do którego wiąże się integraza. Powyżej miejsca prostego znajdują się jeszcze dwa miejsca wiązania integrazy, które działają jako wzmacniacze. Sekwencje wiązania Int to krótkie nieidentyczne sekwencje powtórzone (Gravel i wsp., 1998). Na Fig. 24 zaznaczono sekwencje miejsca atti oraz inne sekwencje mogące odgrywać rolę w wiązaniu integrazy. Sekwencja miejsca atti zmienia się po włączeniu do integronu kasety. 6 ostatnich zasad pochodzi z kasety. Pomiędzy dwoma włączonymi kasetami powstaje sekwencja oznaczana jako attc (zaznaczona na rysunku), będąca hybrydą elementów 59-be tych kaset. Kaseta może być wycięta z dowolnego miejsca w szyku integronu poprzez rekombinacje pomiędzy miejscami attc kontrolowanym przez integrazę. Powstająca przejściowa forma kolista może być później włączona przez ten sam enzym w miejsce atti, co umożliwia ekspresję tej kasety z promotora znajdującego się w obszarze genu integrazy. Kasety genowe zazwyczaj kodują jedną otwartą ramkę odczytu, ale znane są również takie, w których można wyróżnić dwie otwarte ramki odczytu. W takich przypadkach jedna z nich może warunkować oporności na antybiotyk, a druga często koduje białko o nieznanej funkcji (Wolinowska i wsp., 2002). Prawdopodobnie podobną sytuację obserwujemy w opisywanym w tej pracy integronie. Wydaje się, że gen kodujący reduktazę dihydrofolianową oraz gen kodujący acetylotransferazę aminoglikozydową są częścią jednej kasety, bowiem nie można pomiędzy nimi wyznaczyć miejsca attc. Nie występuje też między nimi region międzygenowy. 65

66 Fig. 24. Organizacja genetyczna integronu pok1. Na schemacie kolorowymi strzałkami zaznaczono ORF znajdujące się w integronie (inti1 koduje integrazę, dhfr, AAC (6 )-Ib, bla, qacδe kodują, odpowiednio, reduktazę dihydrofolianową, acetylotransferazę aminoglikozydową, β-laktamazę oraz białko warunkujące oporność na czwartorzędowe związki amoniowe i bromek etydyny. Powiększono region międzygenowy, w którym znajduje się miejsce atti oraz regiony, w których znajdują się miejsca attc. Strzałkami zaznaczono zaproponowane sekwencje powtórzone oraz ich odwrócenia rozpoznawane przez integrazę. Pionową strzałką zaznaczono miejsce włączania kasety. Pogrubioną czcionką oznaczono promotory P c, P int oraz P qacδe. Zaznaczono również miejsce oddziaływania z represorem transkrypcji podczas indukcji odpowiedzi SOS. Wykazano wcześniej (Guerin i wsp., 2009), że odpowiedź SOS kontroluje ekspresję integrazy superintegronu V. cholerae oraz integronów klasy I poprzez wiązanie białka represorowego LexA do miejsca docelowego znajdującego się w obszarze promotora genu integrazy (MAZEL i wsp., 2011). Na Fig. 24 zaznaczono potencjalne miejsce oddziaływania z represorem transkrypcji. W celu wyznaczenia tego miejsca wykorzystano sekwencje konsensusowe ustalone przez Mazela i współpracowników (Mazel i wsp., 2011) (Fig. 25). 66

67 Fig. 25. Reprezentatywne przykłady miejsc wiązania białka LexA zidentyfikowane powyżej różnych genów integrazy mobilnych integronów z zaznaczeniem klasy integrazy (1-5). Zaprezentowane sekwencje pochodzą z: E. coli psa (GenBank: AAA92752), Providencia stuartii ABR23a (GenBank: ABG21674), Serratia marcescens AK9373 (GenBank: BAA08929) oraz Vibrio salmonicida VS224 prvs1 (GenBank: CAC35342). Na prawym panelu zaprezentowano logo (Crooks i wsp., 2004) profilu użytego do szukania miejsca wiązania represora LexA w β/γ Proteobacteria. Regulon SOS jest globalną siecią regulacyjną, zaangażowaną głównie w naprawę uszkodzeń DNA, która jest kontrolowana przez białko represorowe LexA (Walker, 1984). Do represji genów regulonu dochodzi w wyniku wiązaniu białka LexA do specyficznych sekwencji obecnych w ich regionach promotorowych. U większości β i γ Proteobacteria miejsce to stanowi 16-nukleotydowa, sekwencja o strukturze paindromu (CTGTatatatatACAG) (Walker, 1984). Odpowiedź SOS jest indukowana obecnością jednoniciowego DNA, który wiąże się niespecyficznie do białka rekombinacyjnego RecA, umożliwiając katalityczna inaktywację białka LexA (Littre, 1991), a tym samym indukcję odpowiedzi SOS. Wykazano, że ekspresja ponad 40 genów u E. coli jest regulowanych przez represor LexA. Są to geny zaangażowane w stabilizację widełek replikacyjnych, naprawę DNA oraz podział komórki (Fernandez de Henestrosa, 2000). Wykazano również, że niektóre powszechnie stosowane antybiotyki i związki antybakteryjne, takie jak: fluorochinolony, trimetoprim i β-laktamy, mogą wywoływać odpowiedź SOS, a więc mogą również indukować ekspresję genu integrazy. Presja antybiotyku może zatem przyczyniać się do rozpowszechniania genów oporności poprzez stymulowanie wycinania i wbudowywania kaset opornościowych w integronach. Potencjalny produkt białkowy orf37 pok1 wykazuje podobieństwo sekwencji aminokwasowej (98%) do TnpM - modulatora transpozonu Tn21. W genomie pok1 nie występują jednak inne geny pochodzące z Tn21. Wiele transpozonów niosących determinanty oporności należy do podgrupy Tn21 z rodziny Tn3 (Grinsted i wsp., 1990). Transpozony te spotyka się często w dużych plazmidach koniugacyjnych o szerokim zakresie gospodarzy. Tn21 niesie geny zaangażowane w proces transpozycji oraz operon warunkujący oporność na jony rtęci (mer). Tn21 wykorzystuje mechanizm transpozycji replikacyjnej i ulega insercji w dość przypadkowe miejsca genomu (Liebert i wsp., 1999). Transpozon ten opisano po raz pierwszy jako składnik plazmidu NR1 67

68 (R100), wyizolowanego z szczepu Shigella flexneri (Nakaya i wsp., 1960). Liebert i współpracownicy przedstawili organizację genetyczną elementu Tn21 (Liebert i wsp., 1999), którą przedstawiono na Fig. 26. Fig. 26. Schemat organizacji genetycznej Tn21 (wg Liebert i wsp., 1999; zmodyfikowano). Region transpozycyjny składa się z genów transpozazy (tnpa), resolwazy (tnpr), potencjalnego regulatora transpozycji (tnpm) oraz miejsca res. Kaseta aada1 koduje transferazę aminoglikozydów oraz zawiera miejsce 59- be. Strzałki oznaczają kierunek transkrypcji. Moduł tni odpowiada za transpozycję integronu, w Tn21 uległ częściowej delecji. Operon mer składa się z genów regulatorowych merd i merr oraz genów struktury mert, merp, merc i mera. Zaznaczono również dwie otwarte ramki odczytu o nieznanej funkcji ufr1 (mere) i urf2. urf2m jest hipotetyczną ramką odczytu, która mogła istnieć przed wbudowaniem integronu. Pionowe ramki oznaczają odwrócone (IR) powtórzenia transpozonu oraz sekwencji inercyjnych. TE z rodziny Tn3 są zazwyczaj otoczone odwróconymi powtórzonymi sekwencjami (IR) o długości 38 pz (Sherratt, 1989). Transpozycja transpozonu Tn21 generuje 5 pz duplikacje miejsca docelowego, w obrębie bogatej w pary AT sekwencji docelowej (Plasterk, 1995). W sekwencji plazmidu pok1 wyróżniono 22-nukleotydowe odwrócone powtórzenia flankujące duży fragment DNA, zawierający gen tnpm oraz integron. Sekwencje te są podobne do odwróconych powtórzeń elementu inercyjnego należącego do rodziny IS6 (powtórzenia wyróżnione w sekwencji plazmidu pok1 są jednak dłuższe). Wbudowanie elementu z tej rodziny zazwyczaj powoduje stworzenie 8-nukleotydowych prostych powtórzeń. Na Fig. 27 przedstawiono organizację genetyczną fragmentu pok1 zawierającego wspomniane IR. 68

69 Fig. 27. Organizacja genetyczna potencjalnego transpozonu plazmidu pok1. Pionowymi kreskami zaznaczono odwrócone powtórzenia (IR L i IR R, ang. inverted repeats). Powiększono regiony międzygenowe zawierające powtórzenia, które zaznaczono na pomarańczowo. W górnym panelu przedstawiono profil zawartości par G+C (Artemis, okno 120 nt). Jak widać na schemacie, obszar oflankowany sekwencjami IR charakteryzuje się wyższą zawartością par GC niż pozostała część plazmidu, co sugeruje nabycie tego elementu DNA drogą HGT. Ponieważ w opisywanym fragmencie nie wyróżniono genów odpowiedzialnych za transpozycję, można przypuszczać, że ten potencjalny element może być mobilizowany in trans, w obecności kompatybilnej transpozazy, kodowanej przez autonomiczne TE Determinanty oporności W genomie plazmidu pok1 wyróżniono 8 potencjalnych determinantów oporności na różne antybiotyki lub środki dezynfekujące. Cztery z nich znajdują się w obrębie integronu. W kolejnych podrozdziałach przedstawiono ich charakterystykę Fosfotransferaza streptomycyny Otwarta ramka odczytu oznaczona jako orf26 koduje potencjalne białko wykazujące % identyczność sekwencji aa z fosfotransferazą streptomycyny A, pochodzącą z różnych przedstawicieli Gammaproteobacteria. Analiza porównawcza, przeprowadzona za pomocą programu BLAST, wykazała, że gen fosfatazy streptomycyny A (stra) jest często usytuowany w różnych plazmidach, w pobliżu genu strb. W sekwencji plazmidu pok1 wyróżniono jedynie gen 69

70 stra. Fosfotransferaza streptomycyny A nadaje komórce oporność na streptomycynę. Streptomycyna jest pierwszym odkrytym antybiotykiem z grupy aminoglikozydów. Antybiotyki aminoglikozydowe działają bakteriobójczo przede wszystkim na bakterie gramujemne. Aminoglikozydy łączą się z rybosomami, co prowadzi do zaburzenia translacji. Innym lub dodatkowym efektem działania jest zmiana integracji błony komórkowej komórki bakteryjnej (Vakulenko i Mobashery, 2003). Poznano kilka mechanizmów oporności na leki tej grupy: (i) pompy aktywnie usuwające antybiotyk (Moore i wsp., 1999), (ii) zmniejszona przepuszczalność (Hancock, 1981), (iii) modyfikacja rybosomów (Poehlsgaard i Doughtwaite, 2005) oraz (iv) inaktywacja antybiotyku poprzez jego modyfikację (Shaw i wsp., 1993). Mechanizm oporności uzyskany dzięki nabyciu przez komórkę genu stra polega na modyfikacji antybiotyku. Kodowana fosfotransferaza przeprowadza reakcję fosforylacji streptomycyny zachodzącej przy węglu 3, w wyniku czego powstaje fosforan streptomycyny nie wykazujący działania antybakteryjnego. Wiele plazmidów z grupy IncP-1 wyizolowanych z oczyszczalni ścieków posiada gen oporności na streptomycynę (Schluter, 2007). Poszukiwanie konserwowanych domen białkowych pozwoliło zakwalifikować Orf26 do podrodziny 3 -fosfotransferaz aminoglikozydów-aph (kod cdd: cd05120). Członkowie tej rodziny katalizują przeniesienie grupy γ-fosforanowej z ATP na antybiotyk glikozydowy, przede wszystkim na: kanamycynę, streptomycynę, neomycynę oraz genamycynę. Gen APH znajdowany jest w obrębie transpozonów i plazmidów. Uważa się że pierwotnie stanowił on mechanizm obronny dla szczepów produkujących antybiotyk. Domena charakterystyczna dla rodziny stra znajduje się między 22 a 280 aminokwasem. W sekwencji opisywanej fosfotransferazy wyróżniono również miejsca aktywne oraz miejsca wiązania ATP i antybiotyku (Fig. 28). 1 KKPQEFVIRKLKEPPLNRTNI FFGESHSDWLPVRGGESGDFVFRRGDGHAFAKIAPASRRGELAG ERDRLIWLKGRGVACPEVINWQEEQEGACLVITAIPGVPAADLSGADLLKAWPSMGQQLGAVHSL SVDQCPFERRLSRMFGRAVDVVSRNAVNPDFLPDEDKSTPQLDLLARVERELPVRLDQERTDMVV CHGDPCMPNFMVDPKTLQCTGLIDLGRLGTADRYADLALMIANAEENWAAPDEAERAFAVLFNVL GIEAPDRERLAFYLRLDPLT WG 282 Fig. 28. Sekwencja aminokwasowa fosfotransferazy streptomycyny kodowanej w obrębie pok1. Obramowaniem zaznaczono konserwowaną domenę charakterystyczną dla 3 fosfataz aminoglikozydów. Kolorem żółtym oznaczono miejsca aktywne. Kolorowymi literami aminokwasy zaangażowane w wiązanie ATP niebieskie oraz wiązanie antybiotyku czerwone. 70

71 Syntaza dihydroptrynianowa Potencjalny produkt białkowy orf27 pok1 wykazuje podobieństwo sekwencji aa (99-100%) do syntaz dihydropterynianowych pochodzących z różnych szczepów bakterii. Geny odpowiedzialne za powstawanie tego enzymu zlokalizowane są w plazmidach, najczęściej w plazmidach niosących liczne determinanty oporności. Syntaza dihydropterynianowa nadaje komórce oporność na sulfonamidy. Antybiotyki tej grupy działają bakteriostatycznie poprzez zaburzenie syntezy kwasu foliowego. Sulfonamid zastępuje kwas p-aminobenzoesowy i uniemożliwia syntezę kwasu foliowego, co prowadzi do zahamowania syntezy nukleotydów i uniemożliwia namnażanie się bakterii. Plazmidowe geny nadające komórce oporność na sulfonamidy to: sul1, sul2 oraz sul3 (Swedberg i Sköld, 1983; Perreten i Berlin, 2003). Mechanizm oporności związany z obecnością genu sul2, który zidentyfikowano w pok1, polega na wytwarzaniu enzymu syntazy dihydropterynianowej, katalizującej reakcję kondensacji kwasu p-aminobenzoesowego w biosyntezie kwasu foliowego (kod cdd: cd00739). Dodatkowa ilość enzymu umożliwia biosyntezę kwasu foliowego w obecności sulfonamidu Białka warunkujące odporność na tetracyklinę Otwarte ramki orf44 i orf45 zostały zdefiniowane, odpowiednio, jako geny tetr i teth. Sekwencje aminokwasowe kodowanych przez nie białek wykazują podobieństwo (100%) do białek pochodzących z różnych przedstawicieli Gammaprotobacteria, które warunkują oporność na tetracyklinę. Analiza porównawcza, przeprowadzona ze pomocą programu BLAST, wykazała, że geny te są często zlokalizowane, z zachowaniem syntenii, w obrębie plazmidów i transpozonów (Kehrenberg i wsp., 1998). Tetracyklina i większość jej pochodnych wykazuje działanie antybakteryjne poprzez zahamowanie wzrostu bakterii. Po wniknięciu do komórki, oddziałuje z rybosomami, co prowadzi do zablokowania syntezy białek (uniemożliwiają wiązanie się z aminoacylo-trna). Są to antybiotyki dość uniwersalne, dlatego też działają na wiele bakterii - zarówno gramujemnych, jak i gramdodatnich (Roberts, 2005). Możliwy jest również inny mechanizm, bowiem niektóre pochodne tetracykliny wiążą się z rybosomem słabo lub wcale, natomiast oddziałują z błoną komórkową (Rasmussen i wsp., 1991). Zidentyfikowano różne mechanizmy oporności na antybiotyki tej grupy: (i) pompy aktywnie usuwające tetracykliny, (ii) wytwarzanie białek chroniących rybosom, czy (iii) enzymatyczna inaktywacja (van Hoek i wsp., 2011). Poznano dotąd ponad 40 różnych determinantów oporności. Geny kodujące pompy i białka chroniące rybosom są identyfikowane 71

72 u gramdodatnich i gramujemnych bakterii, zarówno tlenowych jak i beztlenowych, natomiast enzymatyczna inaktywacja antybiotyku została opisana tylko dla bakterii gramujemnych. Gen tetr koduje represor transkrypcji. Białka z tej rodziny regulatorów są zaangażowane w kontrolę transkrypcji genów kodujących pompy aktywnie usuwające antybiotyki, szlaków biosyntezy antybiotyków, odpowiedzi na stres osmotyczny i substancje toksyczne, kontrolę szlaków katabolicznych oraz procesów różnicowania i patogenności (Ramos i wsp., 2005). Białka TetR mogą działać na dwa sposoby: mogą się wiązać bezpośrednio do operatora np. TetR wiąże się z genem teta i hamuje jego transkrypcję przy braku tetracykliny, alternatywnie mogą być zaangażowane w regulacyjną kaskadę, w której białko TetR może być modulowane przez inny regulator, lub TetR może wywoływać odpowiedź komórkową. Analiza w bazie Pfam pozwoliły wyróżnić w sekwencji TetR pok1 charakterystyczne domeny - N-końcową (PF00440) i C-końcową (PF02909). Domena N-końcowa warunkuje wiązanie DNA poprzez motyw HTH. Liczne regulatory transkrypcji charakteryzują się podobnymi domenami. Na podstawie podobieństwa sekwencji, produkt genu tetr jest zaliczany do podrodziny białek grupujących represory kontrolujące poziom wrażliwości na hydrofobowe antybiotyki i detergenty. Domena C-końcowa odpowiada za wiązanie się z genem teta (nie wyróżniony w sekwencji plazmidu pok1) i hamuje jego ekspresję pod nieobecność tetracykliny (Fig. 29). 1 MAKLDKEQV IDNALILLNEVGIEGLTTRKLAQKIGVEQPTLYWHVKNKRALLDAL AETIL QKHHHHV LPLPNETWQDFLRNNAKSFRQALLMYRDGGKIHAGTRPSESQFETSEQQLQFL CDAGFSLSQAVYALSSIAHFTLGSVLETQEHQESQKEREKVETDTVAYPPLLTQAVAIMD SDNGDAAFLFVLDVMISGLETV LKSAK 207 Fig. 29. Sekwencja aminokwasowa białka TetR kodowanego w obrębie pok1. Obramowaniem zaznaczono konserwowane domeny na niebiesko N-końcową, na żółto C-końcową. Czerwoną czcionka zaznaczono motyw HTH. Produkt genu teth to pompa usuwająca antybiotyk klasy H. Dzięki analizom w bazach Pfam i Conserved Domain Database w sekwencji Orf45 zidentyfikowano domenę typową dla rodziny białek MFS (ang. major facilitator superfamily; PF07690), nazywanej również rodziną uniporter-symporter-antyporter. Białka tej rodziny ułatwiają transport różnych substratów (jonów, leków, neurotransmitierów, nukleozydów, aminokwasów i peptydów) z cytoplazmy do błony wewnętrznej:. Białka zaliczane do tej grupy maja zazwyczaj długość od 400 do

73 aminokwasów i zawierają 12 helis transbłonowych. W sekwencji Orf45, długości 400 aa, wyróżniono aż 11 helis transbłonowych (program TMHMM Server v. 2.0) (Fig. 30). 1 MNKSIII ILLITVLDAIGIGLIMPVLPTLLNEFVSENSLATHYGVLLALYATMQVIFAPI LGRLSDKYGRKPILLFSLLGAALDYLLMAFSTTLWMLYIGRIIAGITGATGAVCASAMSD VTPAKNRTRYFGFLGGAFGVGLIIGPMLGGLLGDISAHMPFIFAAISHSILLILSLLFFR ETQKREALVANRTPENQTASNTVTVFFKKSLYFWLATYFIIQLIGQIPATIWVLFTQYRF DWNTTSIGMSLAVLGVLHIFFQAIVAGKLAQKWGEKTTIMISMSIDMMGCLLLAWIGHVW VILPALICLAAGGMGQPALQGYLSKSVDDNAQGKLQGTLVSLTNITGIIGP LLFAFIYSY SVAYWDGLLWLMGAILYAMLLITAYFHQRKTTPKAVISTP 400 Fig. 30. Sekwencja aminokwasowa białka TetH kodowanego w obrębie pok1. Obramowaniem zaznaczono konserwowaną domenę. Czerwoną czcionka zaznaczono aminokwasy potencjalnie tworzące pory. Zielonym tłem zaznaczono aminokwasy prawdopodobnie tworzące helisy transbłonowe Reduktaza dihydrofolianowa, acetylotransferaza aminoglikozydowa, β-laktamaza, białko warunkujące oporność na czwartorzędowe związki amoniowe Otwarte ramki odczytu orf39-orf42 warunkują oporność na różne antybiotyki i substancje toksyczne. Geny te znajdują się w obrębie potencjalnego integronu (patrz podrozdział: Integron). Analiza porównawcza wykonana za pomocą programu BLAST wykazała podobieństwo sekwencji aa Orf39, na poziomie %, do reduktaz dihydrofolianowych typu I, spotykanych u różnych przedstawicieli Gammaproteobacteria. Enzym ten nadaje komórce oporność na trimetoprim. Trimetoprim jest syntetycznym chemioterapeutykiem, którego działanie polega na hamowaniu aktywności reduktazy dihydrofolianowej, w wyniku zablokowania jej miejsca aktywnego. Enzym ten jest częścią szlaku biosyntezy kwasu foliowego (katalizuje zależną od NADP redukcję kwasu foliowego), a jego zablokowanie powoduje zatrzymanie syntezy nukleotydów. Mechanizm oporności jest związany z obecnością genu kodującego reduktazę dihydrofolianową, która jest niewrażliwa na antybiotyk i przejmuje funkcje reduktazy kodowanej chromosomowo (wrażliwej na trimetoprim) (Fleming i wsp., 1972). Poszukiwanie konserwowanych domen białkowych umożliwiło wyróżnienie w sekwencji opisywanego enzymu domeny charakterystycznej dla reduktazy dihydrofolianowej oraz potencjalnych miejsc wiązania kwasu foliowego i NADP (Fig. 31). 73

74 1 V KLSLMVAISKNGVIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMGALPNRKYA VVTRSSFTSDNENVLIFPSIKDALTNLKKITDHVIVSGGGEIYKSLIDQADTLHISTIDI EPEGDVYFPEIPSNFRPVFTQDFASNINYSYQIWQK G 157 Fig. 31. Sekwencja aminokwasowa reduktazy dihydrofolianowej kodowanej w obrębie pok1. Obramowaniem zaznaczono konserwowaną domenę. Czerwoną czcionka zaznaczono aminokwasy potencjalnie wiążące kwas foliowy. Zieloną zaznaczono aminokwasy wiążące NADP. Analiza porównawcza wykazała, że Orf40 pok1 wykazuje największe podobieństwo do 6 -N-acetylotransferaz aminoglikozydowych typu Ib (98% identyczności sekwencji aminokwasowych). Enzym ten warunkuje oporność na antybiotyki aminoglikozydowe, uzyskaną dzięki modyfikacji antybiotyku. Białka te są również opisywane jako 6 -N-acetylotransferaza acetylująca fluorochinolony, co może sugerować, że enzym ten nadaje komórce oporność na antybiotyki tej grupy. Stosując program Conserved Domain Search stwierdzono, że w sekwencji enzymu występują domeny charakterystyczne dla acetylotransferaz, tj. domena typowa dla nadrodziny AlcB oraz domena typowa dla nadrodziny N-acetylotransferaz (Fig. 32). Domena AlcB odpowiada za katalizowanie reakcji N-acylowania grup hydroksyloaminowych w N- hydroksybutano - 1, 4 diaminie z sukcynylo-coa i aktywowanie tioestrowej pochodnej kwasu bursztynowego (produktu pośredniego cyklu Krebsa). 1 LPNLAKGLTSGSNDSVTLRLMT EHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLP SVLAQE SVTPYI AMLNGEPIGYAQSYVALGSGDGRWEEETDPGVRGIDQLLANASQLGKG LGTKLVRALVELLFNDPEVTKIQTDPSPSN LRAIRCYEKAGFERQGTVTTPYGPAVYMVQ TRQAFERTRSDA 192 Fig. 32. Sekwencja aminokwasowa acetylotransferazy aminoglikozydowej kodowanej w obrębie pok1. Obramowaniem zaznaczono konserwowane domeny na różowo domenę AlcB, na niebiesko domenę charakterystyczną dla acetylotransferaz GNAT. Otwarta ramka odczytu orf41 została zidentyfikowana jako gen kodujący β-laktamazę klasy D - enzym nadający komórce oporność na antybiotyki β-laktamowe. Działanie antybiotyków tej grupy polega na zahamowaniu syntezy ściany komórkowej poprzez wiązanie do tzw. białek wiążących penicylinę (ang. penicillin binding proteins, PBPs.) i oddziaływanie z peptydoglikanami obecnymi w ścianie, co skutkuje jej osłabieniem prowadzi do śmierci komórki. 74

75 Najważniejszym i najbardziej powszechnym mechanizmem oporności polega na hydrolizie w cząsteczce antybiotyku wiązania β-laktamowego, niezbędnego do jego działania. Biorąc pod uwagę funkcjonalność i charakterystykę molekularną β laktamaz, wyróżniono kilka klas tych enzymów. Oprócz wytwarzania enzymu możliwy jest inny mechanizm oporności, polegający na modyfikacji białek wiążących penicylinę. Wówczas, ich wiązanie z antybiotykiem staje się niemożliwe i ściana komórkowa nie ulega zniszczeniu (Bradford, 2001). W sekwencji Orf41 zidentyfikowano sekwencję charakterystyczną dla transpeptydaz (Pfam: PF00905), do których należą białka wiążące penicylinę. Transpeptydazy to enzymy uczestniczące w budowie ściany komórkowej, odpowiadają za tworzenie mostków łączących podjednostki peptydoglikanu. Z kolei Orf42 kodowane w obrębie pok1 wykazuje znaczące podobieństwo do genu oznaczanego jako qacδe1. Jest to defektywny gen nadający komórce częściową oporność na czwartorzędowe związki amoniowe i bromek etydyny, który jest charakterystyczny dla konserwowanej części 3 integronów klasy I. Czwartorzędowe związki amoniowe to amfoteryczne surfaktanty, często używane jako środki antyseptyczne i dezynfekcyjne. Ich stosowane przyczynia się do selekcji fenotypów wieloopornych, determinowanych przez integrony (Gaze i wsp., 2005). Oporność na te związki wynika głownie z obecności genu qac kodującego białka tworzące pompę usuwającą szkodliwe związki z komórki. W sekwencji Orf42 występuje domena typowa dla nadrodziny białek oporności wielolekowej (Pfam: PF00893). Liczne białka z tej rodziny zaangażowane są w proces usuwania z komórki toksycznych związków, któremu towarzyszy napływ do komórki protonów Dodatkowy ładunek genetyczny plazmidu pok1 Moduły genetyczne wyróżnione w sekwencji pok1, które opisano w poprzednich rozdziałach, zajmują większą część genomu plazmidu. W niniejszym rozdziale przedstawiono analizę 13 ORF leżących poza ww. modułami. Dziewięć z nich koduje hipotetyczne białka o nieznanej funkcji, a blisko połowa wykazuje podobieństwo sekwencji do białek kodowanych w genomie Wohlfahrtiimonas chitiniclastica SH Transferaza adenozynofosforanu SoFic Otwarta ramka odczytu orf03 koduje potencjalne białko wykazujące największe podobieństwo sekwencji aa (96%) do transferazy adenozynofosforanu Wohlfahrtiimonas chitiniclastica SH04 (GenBank: WP_ ). Białka pokrewne (podobieństwo sekwencji rzędu 66-67%) 75

76 zostały przypisane w bazach danych do rodziny Fic/DOC (PF02661). Rodzina ta składa się z białek zaangażowanych w filamentację indukowaną przez camp (Fic) oraz eliminację komórek pozbawionych profaga P1 (Doc). Białka Fic są zaangażowane w podział komórki i mogą odgrywać rolę w syntezie kwasu p-aminobenzoesowego oraz kwasu foliowego. Są to enzymy zmieniające inne białka poprzez dołączenie grupy adenozyno monofosforanu. Większość członków tej rodziny zawiera konserwowany motyw HPFXXGNG. Motyw ten został również znaleziony w sekwencji Orf03, w obrębie domeny charakterystycznej dla białek z rodziny Fic/DOC (Fig. 33). W opisywanej sekwencji znajduję się również domena charakterystyczna dla N-końcowej części białek z tej samej rodziny (Fic_N, PF:13784). Fig. 33. Struktura domenowa białka Orf03 plazmidu pok1. Zaznaczono zasięg konserwowanej domeny Fic\DOC oraz sekwencję charakterystycznego dla niej motywu Białko z rodziny SNF Białko pokrewne Orf04 (61-74% identyczności sekwencji aminokwasowej) mają aktywność helikaz (GenBank: WP_ , WP_ ). W sekwencji Orf04 wyróżniono domenę charakterystyczna dla białek zaangażowanych w ATP-zależne rozwijanie RNA lub DNA (DEXDc, Cdd: cd00046) oraz domenę często spotykaną w helikazach (HELICc, Cdd: cd00079) (Fig. 34). Fig. 34. Struktura domenowa białka Orf04 plazmidu pok1. Zaznaczono zasięg konserwowanych domen oraz miejsca wiązania ATP, nukleotydów oraz potencjalne miejsce wiązania jonów magnezu Inwertaza DNA Potencjalny produkt białkowy orf10 wykazuje 99% identyczność sekwencji aminokwasowej z białkiem Wohlfahrtiimonas chitiniclastica SH04, opisanym jako inwertaza DNA (GenBank: 76

77 ELV ). Należy podkreślić, że kolejne najbardziej podobne białko (90% identyczności) również pochodzi z Wohlfahrtiimonas chitiniclastica SH04 i zostało opisane przez deponujących jako inwertaza DNA lambdoidalnego profaga e14 (GenBank: ELV ). Inne pokrewne białka są definiowane jako inwertazy DNA lub resolwazy. Za pomocą programu Conserved Domain Search (NCBI) zidentyfikowano w sekwencji Orf10 domenę katalityczną charakterystyczną dla rekombinaz serynowych (SR_ResInv, Cdd: cd03768), do których należą resolwazy, inwertazy, integrazy oraz transpozazy (Fig. 35). Fig. 35. Struktura molekularna białka Orf10 plazmidu pok1. Zaznaczono zasięg konserwowanych domen oraz aminokwasy zaangażowane w aktywność białka Resolwaza Sekwencja aminokwasowa Orf35 wykazuje 100% identyczność z sekwencją resolwazy kodowanej w plazmidzie pab5s9 Aeromonas bestiarium (GenBank: YP_ ). orf35 jest zlokalizowana w obszarze pok1 wykazującym duże podobieństwo do sekwencji plazmidu pab5s9 (patrz rozdział: Systemy replikacyjne) (nie stwierdzono, aby we wspomnianym plazmidzie ww. ORF znajdowała się w obrębie transpozonu). Inne białka pokrewne Orf35 (identyczność sekwencji aminokwasowej 82-88%) są określane jako potencjalne resolwazy, i występują u różnych przedstawicieli Gammaproteobacteria (GenBank: WP_ , AAP , WP_ ). W przypadku Pseudomonas areuginosa sekwencja pokrewna orf35 (GenBank: AAP ) znajduje się w obrębie wyspy genomowej (Klockgether i wsp., 2004). Należy zauważyć, że sekwencje aa wszystkie białek pokrewnych Orf35 są o około 90 aa dłuższe. Wyjątek stanowi sekwencja pochodząca z plazmidu pab5s9 o takiej samej długości. Na Fig. 36 przedstawiono schematycznie strukturę molekularną Orf35. W sekwencji wyróżniono domenę katalityczna charakterystyczną dla rekombinaz serynowych (SR_ResInv, Cdd: cd03768), do których należą resolwazy, inwertazy, integrazy oraz transpozazy, a także domenę HTH, charakterystyczną dla białek Hin i im pokrewnych (HTH_Hin, Cdd: cd00569). W rekombinazie Hin wyróżnia się domenę wiążącą DNA (HTH_Hin) oraz domenę katalitycznej. Rozdział kointegratu przez resolwazę transposonów z rodziny Tn3 wymaga utworzenia 77

78 synaptosomu z trzech dimerów resolwazy związanych z dwoma miejscami res. W sekwencji opisywanej potencjalnej resolwazy znalezione zostały aminokwasy prawdopodobnie biorące udział w tworzeniu synaptosomu. Fig. 36. Struktura molekularna białka Orf35 plazmidu pok1. Zaznaczono zasięg konserwowanych domen oraz aminokwasy zaangażowane w aktywność białka Hipotetyczne białka o nieznanej funkcji Dziewięć ORF plazmidu pok1 koduje hipotetyczne białka o nieznanej funkcji. Jedna z nich, orf01, koduje białko konserwowane w genomie Wohlfahrtiimonas chitiniclastica SH04 (GenBank: ELV ). W sekwencji tej nie stwierdzono występowania konserwowanych domen i motywów. Również białko Orf13 oraz Orf24 kodują białka konserwowane w W. chitiniclastica SH04 - GenBank, odpowiednio: ELV (76% identyczności sekwencji aa) oraz ELV (96% identyczności). Pozostałe białka pok1 wykazujące duże podobieństwo z białkami ww. bakterii to: Orf08 (GenBank: ELV ) i Orf09 (GenBank: ELV ) - w obu przypadkach 99% identyczności sekwencji. Para orf08-orf09 konserwowana jest również w genomie Legionella shakespearei (odpowiednio, 62% podobieństwa, GenBank: WP_ i 56% i WP_ ). Poszukiwanie konserwowanych domen białkowych ujawniło w sekwencji Orf08 obecność domeny charakterystycznej dla konserwowanych białek o nieznanej funkcji DUF1778 (Pfam: 08681). Domena ta obejmuje prawie całą długość wyróżnionej sekwencji. W sekwencji Orf09 wyróżniono natomiast domenę występującą u acetylotransferaz z rodziny GNAT (Pfam: PF13508). Otwarta ramka odczytu orf28 koduje białko wykazujące 97% identyczność sekwencji aa z hipotetycznym białkiem Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 (GenBank: YP_ ). Zdeponowana w bazie danych sekwencja polipeptydu o długości 74 aa (równa długości Orf28) została opisana jako białko niekompletne. Pokrewne białka o 78

79 wysokiej identyczności sekwencji (96-98%) są długości 60aa (Photobacterium damselae subsp. Piscicida, GenBank: YP_ , Acinetobacter nosocomialis, GenBank: WP_ ). Wyjątek stanowi hipotetyczne białko z E. coli (GenBank: WP_ ) - o długości 102 aa. Kolejnym hipotetycznym białkiem jest Orf29. Pokrewne białko (96% identyczności sekwencji), o długości Orf29, kodowane jest w genomie E. coli (GenBank: WP_ ). Należy zwrócić uwagę na wysokie podobieństwo (97%) sekwencji Orf29 z sekwencjami białek opisanych jako białka replikacyjne RepC z różnych plazmidów przedstawicieli Gammaproteobacteria (S. enterica subsp. enterica serovar Typhimurium str. T000240, GenBank: YP_ i E. coli, GenBank: WP_ ). Orf31 i Orf36 kodują hipotetyczne białka wykazujące największe podobieństwo sekwencji do białek kodowanych w plazmidzie pab5s9 Aeromonas bestiarium (GenBank, odpowiednio: ABR % identyczność sekwencji aa, i NP_ % identyczność sekwencji). Stanowią one część większego segmentu plazmidu pok1, konserwowanego w plazmidzie pab5s9. Tuż powyżej orf36 znajduje się gen modulatora transpozonu Tn21 (otwarte ramki odczytu Orf36 i TnpM nachodzą na siebie na obszarze kodującym 14 aminokwasów), co sugeruje, iż orf39 nie jest kompletna, i zapewne jej ciągłość została przerwana w wyniku zamierzchłych zdarzeń transpozycyjnych. 3. Analiza funkcjonalna wybranych modułów genetycznych plazmidu pok1 W wyniku przedstawionej w tej pracy analizy bioinformatycznej sekwencji genomu plazmidu pok1 wyróżniono różne moduły genetyczne. W niniejszym rozdziale przedstawiono wyniki analiz funkcjonalnych wybranych modułów Moduł replikacyjny. W genomie pok1 wyróżniono trzy potencjalne systemy replikacyjne (oznaczone jako REP1, REP2 i REP3) (Fig. 1) Analiza funkcjonalna systemów replikacyjnych. W pierwszym etapie analizy sprawdzono, który z obecnych systemów REP jest funkcjonalny w E. coli TG1. W tym celu przygotowano konstrukty obejmujące fragmenty plazmidu pok1, zawierające, odpowiednio, REP1, REP2, REP3 oraz REP1+REP3. W każdym przypadku 79

80 plazmid pok1 poddano trawieniu odpowiednimi enzymami restrykcyjnymi. Następnie uzyskane fragmenty poddano ligacji (cyrkularyzacja fragmentów). Fig. 37. Schematy fragmentów restrykcyjnych wykorzystywanych do sprawdzenia funkcjonalności systemów replikacyjnych. Za pomocą strzałek zaznaczono zasięg i orientację transkrypcyjną potencjalnych ORF. Kolorami wyróżniono podstawowe moduły genetyczne: na zielono moduły odpowiedzialne za replikację plazmidu, na pomarańczowo systemy odpowiedzialne za stabilne utrzymywanie plazmidu w komórce (systemy partycyjne, restrykcjimodyfikacji oraz toksyna-antytoksyna), na niebiesko ruchome elementy genetyczne zintegrowane z genomem plazmidu, na fioletowo determinanty oporności. Zaznaczono systemy replikacyjne REP1, REP2 i REP3 oraz fenotypy opornościowe: Tc r oporność na tetracyklinę, Ap r oporność na antybiotyki β-laktamowe, Am r opornośc na aminoglikozydy, Tr r oporność na trimetoprim, Su r oporność na sulfonamidy, Sm r oporność na streptomycynę. 80

Ćwiczenia 1 Wirtualne Klonowanie Prowadzący: mgr inż. Joanna Tymeck-Mulik i mgr Lidia Gaffke. Część teoretyczna:

Ćwiczenia 1 Wirtualne Klonowanie Prowadzący: mgr inż. Joanna Tymeck-Mulik i mgr Lidia Gaffke. Część teoretyczna: Uniwersytet Gdański, Wydział Biologii Katedra Biologii Molekularnej Przedmiot: Biologia Molekularna z Biotechnologią Biologia II rok ===============================================================================================

Bardziej szczegółowo

Klonowanie molekularne Kurs doskonalący. Zakład Geriatrii i Gerontologii CMKP

Klonowanie molekularne Kurs doskonalący. Zakład Geriatrii i Gerontologii CMKP Klonowanie molekularne Kurs doskonalący Zakład Geriatrii i Gerontologii CMKP Etapy klonowania molekularnego 1. Wybór wektora i organizmu gospodarza Po co klonuję (do namnożenia DNA [czy ma być metylowane

Bardziej szczegółowo

Zakład Biologii Molekularnej Materiały do ćwiczeń z przedmiotu: BIOLOGIA MOLEKULARNA

Zakład Biologii Molekularnej Materiały do ćwiczeń z przedmiotu: BIOLOGIA MOLEKULARNA Zakład Biologii Molekularnej Materiały do ćwiczeń z przedmiotu: BIOLOGIA MOLEKULARNA Zakład Biologii Molekularnej Wydział Farmaceutyczny, WUM ul. Banacha 1, 02-097 Warszawa IZOLACJA DNA Z HODOWLI KOMÓRKOWEJ.

Bardziej szczegółowo

Ćwiczenie 1. Oznaczanie wrażliwości szczepów na metycylinę

Ćwiczenie 1. Oznaczanie wrażliwości szczepów na metycylinę XI. Antybiotyki i chemioterpeutyki ćwiczenia praktyczne W przedstawionych ćwiczeniach narysuj i zinterpretuj otrzymane wyniki badań mechanizmów oporności. Opisz rodzaje krążków użytych do badań oraz sposób

Bardziej szczegółowo

Przynieść kalkulator, jeden na osobę (nie w telefonie!)

Przynieść kalkulator, jeden na osobę (nie w telefonie!) Uniwersytet Gdański, Wydział Biologii Katedra Biologii Molekularnej Przedmiot: Biologia Molekularna z Biotechnologią Biologia II rok ======================================================== Ćwiczenie 2

Bardziej szczegółowo

TaqNovaHS. Polimeraza DNA RP902A, RP905A, RP910A, RP925A RP902, RP905, RP910, RP925

TaqNovaHS. Polimeraza DNA RP902A, RP905A, RP910A, RP925A RP902, RP905, RP910, RP925 TaqNovaHS RP902A, RP905A, RP910A, RP925A RP902, RP905, RP910, RP925 RP902A, RP905A, RP910A, RP925A RP902, RP905, RP910, RP925 TaqNovaHS Polimeraza TaqNovaHS jest mieszaniną termostabilnej polimerazy DNA

Bardziej szczegółowo

Techniki molekularne w mikrobiologii SYLABUS A. Informacje ogólne

Techniki molekularne w mikrobiologii SYLABUS A. Informacje ogólne Techniki molekularne w mikrobiologii A. Informacje ogólne Elementy sylabusu Nazwa jednostki prowadzącej kierunek Nazwa kierunku studiów Poziom kształcenia Profil studiów Forma studiów Rodzaj Rok studiów

Bardziej szczegółowo

Instrukcje do ćwiczeń oraz zakres materiału realizowanego na wykładach z przedmiotu Inżynieria bioprocesowa na kierunku biotechnologia

Instrukcje do ćwiczeń oraz zakres materiału realizowanego na wykładach z przedmiotu Inżynieria bioprocesowa na kierunku biotechnologia 1 Zakład Mikrobiologii UJK Instrukcje do ćwiczeń oraz zakres materiału realizowanego na wykładach z przedmiotu Inżynieria bioprocesowa na kierunku biotechnologia 2 Zakład Mikrobiologii UJK Zakres materiału

Bardziej szczegółowo

Drożdżowe systemy ekspresyjne

Drożdżowe systemy ekspresyjne Drożdże Drożdżowe systemy ekspresyjne Zalety: możliwość uzyskania dużej biomasy modyfikacje postranslacyjne eksprymowanych białek transport eksprymowanych białek do pożywki Duża biomasa W przypadku hodowli

Bardziej szczegółowo

Bożena Nejman-Faleńczyk

Bożena Nejman-Faleńczyk Kontrola replikacji fagów lambdoidalnych niosących geny toksyn Shiga w świetle potencjalnych nowych metod ich wykrywania i terapii zakażeń enterokrwotocznymi szczepami Escherichia coli Bożena Nejman-Faleńczyk

Bardziej szczegółowo

RUCHOME ELEMENTY GENETYCZNE BAKTERII

RUCHOME ELEMENTY GENETYCZNE BAKTERII RUCHOME ELEMENTY GENETYCZNE BAKTERII Skrypt do ćwiczeń 2013 dr hab. Dariusz Bartosik (koordynator zajęć) dr Łukasz Dziewit dr Magdalena Szuplewska Zakład Genetyki Bakterii Instytut Mikrobiologii Wydział

Bardziej szczegółowo

Proteomika: umożliwia badanie zestawu wszystkich lub prawie wszystkich białek komórkowych

Proteomika: umożliwia badanie zestawu wszystkich lub prawie wszystkich białek komórkowych Proteomika: umożliwia badanie zestawu wszystkich lub prawie wszystkich białek komórkowych Zalety w porównaniu z analizą trankryptomu: analiza transkryptomu komórki identyfikacja mrna nie musi jeszcze oznaczać

Bardziej szczegółowo

wykład dla studentów II roku biotechnologii Andrzej Wierzbicki

wykład dla studentów II roku biotechnologii Andrzej Wierzbicki Genetyka ogólna wykład dla studentów II roku biotechnologii Andrzej Wierzbicki Uniwersytet Warszawski Wydział Biologii andw@ibb.waw.pl http://arete.ibb.waw.pl/private/genetyka/ Wykład 5 Droga od genu do

Bardziej szczegółowo

ETYKIETA. Fitmax Easy GainMass proszek

ETYKIETA. Fitmax Easy GainMass proszek ETYKIETA Fitmax Easy GainMass proszek smak waniliowy, truskawkowy, czekoladowy Środek spożywczy zaspokajający zapotrzebowanie organizmu przy intensywnym wysiłku fizycznym, zwłaszcza sportowców. FitMax

Bardziej szczegółowo

Ampli-LAMP Salmonella species

Ampli-LAMP Salmonella species Novazym Products Novazym Polska ul. Żywokostowa 23, 61-680 Poznań, tel. +48 0 61 610 39 10, fax +48 0 61 610 39 11, email info@novazym.com Zestaw do identyfikacji materiału genetycznego bakterii z rodzaju

Bardziej szczegółowo

PROJEKT WSPÓŁFINANSOWANY PRZEZ UNIĘ EUROPEJSKĄ Z EUROPEJSKIEGO FUNDUSZU ROZWOJU REGIONALNEGO 1 z 7

PROJEKT WSPÓŁFINANSOWANY PRZEZ UNIĘ EUROPEJSKĄ Z EUROPEJSKIEGO FUNDUSZU ROZWOJU REGIONALNEGO 1 z 7 Poznań, dnia 28.04.2014 r. BioVentures Institute Spółka z ograniczoną odpowiedzialnością ul. Promienista 83 60 141 Poznań Zapytanie ofertowe nr 01/2014 Projekt Nowa technologia wytwarzania szczepionek

Bardziej szczegółowo

(86) Data i numer zgłoszenia międzynarodowego: , PCT/US99/21960 (87) Data i numer publikacji zgłoszenia międzynarodowego:

(86) Data i numer zgłoszenia międzynarodowego: , PCT/US99/21960 (87) Data i numer publikacji zgłoszenia międzynarodowego: RZECZPOSPOLITA POLSKA (12) OPIS PATENTOWY (19) PL (11) 197408 (21) Numer zgłoszenia: 346772 (13) B1 Urząd Patentowy Rzeczypospolitej Polskiej (22) Data zgłoszenia: 21.09.1999 (86) Data i numer zgłoszenia

Bardziej szczegółowo

Ćwiczenie 3. Amplifikacja genu ccr5 Homo sapiens wykrywanie delecji Δ32pz warunkującej oporność na wirusa HIV

Ćwiczenie 3. Amplifikacja genu ccr5 Homo sapiens wykrywanie delecji Δ32pz warunkującej oporność na wirusa HIV Ćwiczenie 3. Amplifikacja genu ccr5 Homo sapiens wykrywanie delecji Δ32pz warunkującej oporność na wirusa HIV Cel ćwiczenia Określenie podatności na zakażenie wirusem HIV poprzez detekcję homo lub heterozygotyczności

Bardziej szczegółowo

Bioinformatyka Laboratorium, 30h. Michał Bereta mbereta@pk.edu.pl www.michalbereta.pl

Bioinformatyka Laboratorium, 30h. Michał Bereta mbereta@pk.edu.pl www.michalbereta.pl Laboratorium, 30h Michał Bereta mbereta@pk.edu.pl www.michalbereta.pl Zasady zaliczenia przedmiotu Kolokwia (3 4 ) Ocena aktywności i przygotowania Obecnośd Literatura, materiały Bioinformatyka i ewolucja

Bardziej szczegółowo

Narodowy Instytut Leków ul. Chełmska 30/34, 00-725 Warszawa Tel. 022 851-46-70, Fax. 022 841-29-49 www.korld.edu.pl Warszawa, dn. 21.10.2009r.

Narodowy Instytut Leków ul. Chełmska 30/34, 00-725 Warszawa Tel. 022 851-46-70, Fax. 022 841-29-49 www.korld.edu.pl Warszawa, dn. 21.10.2009r. Narodowy Instytut Leków ul. Chełmska 30/34, 00-725 Warszawa Tel. 022 851-46-70, Fax. 022 841-29-49 www.korld.edu.pl Warszawa, dn. 21.10.2009r. Wytyczne postępowania w przypadku wykrycia szczepów pałeczek

Bardziej szczegółowo

ĆWICZENIA Z BIOCHEMII

ĆWICZENIA Z BIOCHEMII ĆWICZENIA Z BIOCHEMII D U STUDENTfiW WYDZIAŁU LEKARSKIEGO Pod redakcją Piotra Laidlera, Barbary Piekarskiej, Marii Wróbel WYDAWNICTWO UNIWERSYTETU JAGIELLOŃSKIEGO ĆWICZENIA Z BIOCHEMII DLA STUDENTÓW WYDZIAŁU

Bardziej szczegółowo

2. Przedmiot zamówienia: Odczynniki chemiczne do izolacji DNA i reakcji PCR, wymienione w Tabeli 1. Nazwa odczynnika Specyfikacja Ilość*

2. Przedmiot zamówienia: Odczynniki chemiczne do izolacji DNA i reakcji PCR, wymienione w Tabeli 1. Nazwa odczynnika Specyfikacja Ilość* Poznao, 6 lutego 2012 r. Zapytanie ofertowe nr 001 /2012 dotyczące zakupu odczynników chemicznych do izolacji DNA i reakcji PCR GENESIS Polska Sp. z o.o Ul. Za Cytadelą 19, 61-659 Poznao NIP 778 13 56

Bardziej szczegółowo

StayRNA bufor zabezpieczający RNA przed degradacją wersja 0215

StayRNA bufor zabezpieczający RNA przed degradacją wersja 0215 StayRNA bufor zabezpieczający RNA przed degradacją wersja 0215 100 ml, 250 ml, 500 ml Nr kat. 038-100, 038-250, 038-500 Nietosyczny roztwór wodny do przechowywania i zabezpieczania różnego rodzaju tkanek

Bardziej szczegółowo

Geny i działania na nich

Geny i działania na nich Metody bioinformatyki Geny i działania na nich prof. dr hab. Jan Mulawka Trzy królestwa w biologii Prokaryota organizmy, których komórki nie zawierają jądra, np. bakterie Eukaryota - organizmy, których

Bardziej szczegółowo

RUCHOME ELEMENTY GENETYCZNE BAKTERII

RUCHOME ELEMENTY GENETYCZNE BAKTERII RUCHOME ELEMENTY GENETYCZNE BAKTERII Skrypt do ćwiczeń dr hab. Dariusz Bartosik (koordynator zajęć) mgr Łukasz Dziewit mgr Anna Klicka mgr Magdalena Szuplewska Zakład Genetyki Bakterii Instytut Mikrobiologii

Bardziej szczegółowo

PathogenFree DNA Isolation Kit Zestaw do izolacji DNA Instrukcja użytkownika

PathogenFree DNA Isolation Kit Zestaw do izolacji DNA Instrukcja użytkownika PathogenFree DNA Isolation Kit Zestaw do izolacji DNA Instrukcja użytkownika Spis treści 1. Zawartość 2 1.1 Składniki zestawu 2 2. Opis produktu 2 2.1 Założenia metody 2 2.2 Instrukcja 2 2.3 Specyfikacja

Bardziej szczegółowo

Ćwiczenie numer 6. Analiza próbek spożywczych na obecność markerów GMO

Ćwiczenie numer 6. Analiza próbek spożywczych na obecność markerów GMO Ćwiczenie numer 6 Analiza próbek spożywczych na obecność markerów GMO 1. Informacje wstępne -screening GMO -metoda CTAB -qpcr 2. Izolacja DNA z soi metodą CTAB 3. Oznaczenie ilościowe i jakościowe DNA

Bardziej szczegółowo

PL 217144 B1. Sposób amplifikacji DNA w łańcuchowej reakcji polimerazy za pomocą starterów specyficznych dla genu receptora 2-adrenergicznego

PL 217144 B1. Sposób amplifikacji DNA w łańcuchowej reakcji polimerazy za pomocą starterów specyficznych dla genu receptora 2-adrenergicznego PL 217144 B1 RZECZPOSPOLITA POLSKA (12) OPIS PATENTOWY (19) PL (11) 217144 (13) B1 Urząd Patentowy Rzeczypospolitej Polskiej (21) Numer zgłoszenia: 391926 (22) Data zgłoszenia: 23.07.2010 (51) Int.Cl.

Bardziej szczegółowo

Rok akademicki: 2014/2015 Kod: EIB-2-206-BN-s Punkty ECTS: 3. Kierunek: Inżynieria Biomedyczna Specjalność: Bionanotechnologie

Rok akademicki: 2014/2015 Kod: EIB-2-206-BN-s Punkty ECTS: 3. Kierunek: Inżynieria Biomedyczna Specjalność: Bionanotechnologie Nazwa modułu: Genetyka molekularna Rok akademicki: 2014/2015 Kod: EIB-2-206-BN-s Punkty ECTS: 3 Wydział: Elektrotechniki, Automatyki, Informatyki i Inżynierii Biomedycznej Kierunek: Inżynieria Biomedyczna

Bardziej szczegółowo

ĆWICZENIE NR 3 BADANIE MIKROBIOLOGICZNEGO UTLENIENIA AMONIAKU DO AZOTYNÓW ZA POMOCĄ BAKTERII NITROSOMONAS sp.

ĆWICZENIE NR 3 BADANIE MIKROBIOLOGICZNEGO UTLENIENIA AMONIAKU DO AZOTYNÓW ZA POMOCĄ BAKTERII NITROSOMONAS sp. ĆWICZENIE NR 3 BADANIE MIKROBIOLOGICZNEGO UTLENIENIA AMONIAKU DO AZOTYNÓW ZA POMOCĄ BAKTERII NITROSOMONAS sp. Uwaga: Ze względu na laboratoryjny charakter zajęć oraz kontakt z materiałem biologicznym,

Bardziej szczegółowo

Wektory DNA - klonowanie molekularne

Wektory DNA - klonowanie molekularne Wektory DNA - klonowanie molekularne Fragment DNA (np. pojedynczy gen) można trwale wprowadzić do komórek gospodarza (tzn. zmusić go do powielania w tym gospodarzu) tylko wtedy, gdy zostanie on wbudowany

Bardziej szczegółowo

Mikroorganizmy Zmodyfikowane Genetycznie

Mikroorganizmy Zmodyfikowane Genetycznie Mikroorganizmy Zmodyfikowane Genetycznie DEFINICJA Mikroorganizm (drobnoustrój) to organizm niewidoczny gołym okiem. Pojęcie to nie jest zbyt precyzyjne lecz z pewnością mikroorganizmami są: bakterie,

Bardziej szczegółowo

Skąd się wzięła biologia syntetyczna? Co to są standardowe części biologiczne?

Skąd się wzięła biologia syntetyczna? Co to są standardowe części biologiczne? Skąd się wzięła biologia syntetyczna? Mało kto zdaje sobie sprawę z tego, że termin "biologia syntetyczna" został ukuty w 1974 roku przez polskiego genetyka i biochemika Wacława Szybalskiego. Biologia

Bardziej szczegółowo

Produkcja biomasy. Termin BIOMASA MIKROORGANIZMÓW oznacza substancję komórek wytwarzaną w wyniku masowej hodowli drobnoustrojów.

Produkcja biomasy. Termin BIOMASA MIKROORGANIZMÓW oznacza substancję komórek wytwarzaną w wyniku masowej hodowli drobnoustrojów. Termin BIOMASA MIKROORGANIZMÓW oznacza substancję komórek wytwarzaną w wyniku masowej hodowli drobnoustrojów. BIAŁKO JEDNOKOMÓRKOWCÓW (SCP single cell protein) biomasa mikroorganizmów stosowana jako źródło

Bardziej szczegółowo

6. Z pięciowęglowego cukru prostego, zasady azotowej i reszty kwasu fosforowego, jest zbudowany A. nukleotyd. B. aminokwas. C. enzym. D. wielocukier.

6. Z pięciowęglowego cukru prostego, zasady azotowej i reszty kwasu fosforowego, jest zbudowany A. nukleotyd. B. aminokwas. C. enzym. D. wielocukier. ID Testu: F5679R8 Imię i nazwisko ucznia Klasa Data 1. Na indywidualne cechy danego osobnika ma (maja) wpływ A. wyłacznie czynniki środowiskowe. B. czynniki środowiskowe i materiał genetyczny. C. wyłacznie

Bardziej szczegółowo

SCENARIUSZ LEKCJI BIOLOGII Z WYKORZYSTANIEM FILMU

SCENARIUSZ LEKCJI BIOLOGII Z WYKORZYSTANIEM FILMU SCENARIUSZ LEKCJI BIOLOGII Z WYKORZYSTANIEM FILMU Czy priony zawsze są szkodliwe? SPIS TREŚCI: Wprowadzenie. Części lekcji. 1. Część wstępna. 2. Część realizacji. 3. Część podsumowująca. Karty pracy. 1.

Bardziej szczegółowo

Spis treści. Wstęp. Obiekt. Pracownia Biologii Molekularnej. Część II. Ekspresja i oczyszczanie białek

Spis treści. Wstęp. Obiekt. Pracownia Biologii Molekularnej. Część II. Ekspresja i oczyszczanie białek Pracownia Biologii Molekularnej Część II Ekspresja i oczyszczanie białek Spis treści 1 Wstęp 2 Obiekt 3 Namnażanie białka w komórkach bakterii Escherichia Coli 3.1 Pożywki do hodowli 3.2 Rozwój hodowli

Bardziej szczegółowo

Spis treści. Przedmowa... XI. Wprowadzenie i biologiczne bazy danych. 1 Wprowadzenie... 3. 2 Wprowadzenie do biologicznych baz danych...

Spis treści. Przedmowa... XI. Wprowadzenie i biologiczne bazy danych. 1 Wprowadzenie... 3. 2 Wprowadzenie do biologicznych baz danych... Przedmowa... XI Część pierwsza Wprowadzenie i biologiczne bazy danych 1 Wprowadzenie... 3 Czym jest bioinformatyka?... 5 Cele... 5 Zakres zainteresowań... 6 Zastosowania... 7 Ograniczenia... 8 Przyszłe

Bardziej szczegółowo

Historia informacji genetycznej. Jak ewolucja tworzy nową informację (z ma ą dygresją).

Historia informacji genetycznej. Jak ewolucja tworzy nową informację (z ma ą dygresją). Historia informacji genetycznej. Jak ewolucja tworzy nową informację (z ma ą dygresją). Czym jest życie? metabolizm + informacja (replikacja) 2 Cząsteczki organiczne mog y powstać w atmosferze pierwotnej

Bardziej szczegółowo

MARKERY MIKROSATELITARNE

MARKERY MIKROSATELITARNE MARKERY MIKROSATELITARNE Badania laboratoryjne prowadzone w Katedrze Genetyki i Ogólnej Hodowli Zwierząt SGGW w ramach monitoringu genetycznego wykorzystują analizę genetyczną markerów mikrosatelitarnych.

Bardziej szczegółowo

XIX. Pałeczki Gram-ujemne część I - ćwiczenia praktyczne

XIX. Pałeczki Gram-ujemne część I - ćwiczenia praktyczne XIX. Pałeczki Gram-ujemne część I - ćwiczenia praktyczne Ćwiczenie 1. Wykonanie preparatu mikroskopowego barwionego metodą Grama Opis preparatu: Ćwiczenie 2. Ocena wzrostu szczepów na podłożach stałych

Bardziej szczegółowo

1. Bakterie mlekowe LAB wykorzystanie w medycynie Bakterie mlekowe LAB (lactic acid bacteria) grupujące mikroorganizmy należące do różnych rodzajów

1. Bakterie mlekowe LAB wykorzystanie w medycynie Bakterie mlekowe LAB (lactic acid bacteria) grupujące mikroorganizmy należące do różnych rodzajów 1. Bakterie mlekowe LAB wykorzystanie w medycynie Bakterie mlekowe LAB (lactic acid bacteria) grupujące mikroorganizmy należące do różnych rodzajów takich jak np. Lactococcus, Lactobacillus, Streptococcus,

Bardziej szczegółowo

Biologia Molekularna Podstawy

Biologia Molekularna Podstawy Biologia Molekularna Podstawy Budowa DNA Budowa DNA Zasady: Purynowe: adenina i guanina Pirymidynowe: cytozyna i tymina 2 -deoksyryboza Grupy fosforanowe Budowa RNA Budowa RNA Zasady: purynowe: adenina

Bardziej szczegółowo

Statystyczna analiza danych

Statystyczna analiza danych Statystyczna analiza danych ukryte modele Markowa, zastosowania Anna Gambin Instytut Informatyki Uniwersytet Warszawski plan na dziś Ukryte modele Markowa w praktyce modelowania rodzin białek multiuliniowienia

Bardziej szczegółowo

Genomic Midi AX Direct zestaw do izolacji genomowego DNA (procedura bez precypitacji) wersja 1215

Genomic Midi AX Direct zestaw do izolacji genomowego DNA (procedura bez precypitacji) wersja 1215 Genomic Midi AX Direct zestaw do izolacji genomowego DNA (procedura bez precypitacji) wersja 1215 20 izolacji Nr kat. 895-20D Pojemność kolumny do oczyszczania DNA wynosi 100 µg 1 Skład zestawu Składnik

Bardziej szczegółowo

AmpliTest Salmonella spp. (Real Time PCR)

AmpliTest Salmonella spp. (Real Time PCR) AmpliTest Salmonella spp. (Real Time PCR) Zestaw do wykrywania sekwencji DNA specyficznych dla bakterii z rodzaju Salmonella techniką Real Time PCR Nr kat.: BAC01-50 Wielkość zestawu: 50 oznaczeń Objętość

Bardziej szczegółowo

na zakup usługi badawczej

na zakup usługi badawczej Łódź, dn. 08.09.2015r. Zapytanie ofertowe nr 1/OF/2015 na zakup usługi badawczej w ramach projektu,, Bakteriofagowy preparat do leczenia zapalenia wymienia u krów wywołanego bakteriami antybiotykopornymi

Bardziej szczegółowo

Regulacja ekspresji operonu ksylozowego

Regulacja ekspresji operonu ksylozowego Bacillus spp. Bacillus spp. A - komórka Bacillus megaterium pod mikroskopem B zdjęcie komórek B.megaterium rosnących w postaci długich łańcuszków. Mikroskopia skaningowa. (Visuals Unlimited) C kolonie

Bardziej szczegółowo

SCENARIUSZ LEKCJI. TEMAT LEKCJI: Podstawowe techniki inżynierii genetycznej. Streszczenie

SCENARIUSZ LEKCJI. TEMAT LEKCJI: Podstawowe techniki inżynierii genetycznej. Streszczenie SCENARIUSZ LEKCJI OPRACOWANY W RAMACH PROJEKTU: INFORMATYKA MÓJ SPOSÓB NA POZNANIE I OPISANIE ŚWIATA. PROGRAM NAUCZANIA INFORMATYKI Z ELEMENTAMI PRZEDMIOTÓW MATEMATYCZNO-PRZYRODNICZYCH Autorzy scenariusza:

Bardziej szczegółowo

1. Na podanej sekwencji przeprowadź proces replikacji, oraz do obu nici proces transkrypcji i translacji, podaj zapis antykodonów.

1. Na podanej sekwencji przeprowadź proces replikacji, oraz do obu nici proces transkrypcji i translacji, podaj zapis antykodonów. mrna 1. Na podanej sekwencji przeprowadź proces replikacji, oraz do obu nici proces transkrypcji i translacji, podaj zapis antykodonów. GGA CGC GCT replikacja CCT GCG CGA transkrypcja aminokwasy trna antykodony

Bardziej szczegółowo

Powiatowa Stacja Sanitarno-Epidemiologiczna w Olecku

Powiatowa Stacja Sanitarno-Epidemiologiczna w Olecku Powiatowa Stacja Sanitarno-Epidemiologiczna w Olecku Zaopatrzenie ludności w wodę W 2010 roku Powiatowa Stacja Sanitarno - Epidemiologiczna w Olecku objęła nadzorem 17 urządzeń służących do zaopatrzenia

Bardziej szczegółowo

białka wiążące specyficzne sekwencje DNA czynniki transkrypcyjne

białka wiążące specyficzne sekwencje DNA czynniki transkrypcyjne białka wiążące specyficzne sekwencje DNA czynniki transkrypcyjne http://www.umass.edu/molvis/bme3d/materials/jtat_080510/exploringdna/ch_flex/chapter.htm czynniki transkrypcyjne (aktywatory/represory)

Bardziej szczegółowo

SPOSÓB PRZEDSTAWIANIA DOKUMENTACJI DOŁĄCZANEJ DO WNIOSKU O DOPUSZCZENIE DO OBROTU PRODUKTU LECZNICZEGO WETERYNARYJNEGO IMMUNOLOGICZNEGO

SPOSÓB PRZEDSTAWIANIA DOKUMENTACJI DOŁĄCZANEJ DO WNIOSKU O DOPUSZCZENIE DO OBROTU PRODUKTU LECZNICZEGO WETERYNARYJNEGO IMMUNOLOGICZNEGO Załącznik nr 2 SPOSÓB PRZEDSTAWIANIA DOKUMENTACJI DOŁĄCZANEJ DO WNIOSKU O DOPUSZCZENIE DO OBROTU PRODUKTU LECZNICZEGO WETERYNARYJNEGO IMMUNOLOGICZNEGO CZĘŚĆ I - STRESZCZENIE DOKUMENTACJI I A IB I B 1 I

Bardziej szczegółowo

Zestaw do izolacji DNA z krwi świeżej i mrożonej

Zestaw do izolacji DNA z krwi świeżej i mrożonej Nr kat. EM05 Wersja zestawu: 1.2014 Zestaw do izolacji DNA z krwi świeżej i mrożonej EXTRACTME jest zastrzeżonym znakiem towarowym firmy BLIRT S.A. www.dnagdansk.com Nr kat. EM05 I. PRZEZNACZENIE ZESTAWU

Bardziej szczegółowo

Biotechnologia i inżynieria genetyczna

Biotechnologia i inżynieria genetyczna Wersja A Test podsumowujący rozdział II i inżynieria genetyczna..................................... Imię i nazwisko.............................. Data Klasa oniższy test składa się z 16 zadań. rzy każdym

Bardziej szczegółowo

Ocena ekspresji genów proangiogennych w komórkach nowotworowych OVP-10 oraz transfektantach OVP-10/SHH i OVP-10/VEGF

Ocena ekspresji genów proangiogennych w komórkach nowotworowych OVP-10 oraz transfektantach OVP-10/SHH i OVP-10/VEGF Agnieszka Gładysz Ocena ekspresji genów proangiogennych w komórkach nowotworowych OVP-10 oraz transfektantach OVP-10/SHH i OVP-10/VEGF Katedra i Zakład Biochemii i Chemii Klinicznej Akademia Medyczna Prof.

Bardziej szczegółowo

Tematyka zajęć z biologii

Tematyka zajęć z biologii Tematyka zajęć z biologii klasy: I Lp. Temat zajęć Zakres treści 1 Zapoznanie z przedmiotowym systemem oceniania, wymaganiami edukacyjnymi i podstawą programową Podstawowe zagadnienia materiału nauczania

Bardziej szczegółowo

PRZYKŁADOWE ZADANIA ORGANICZNE ZWIĄZKI ZAWIERAJĄCE AZOT

PRZYKŁADOWE ZADANIA ORGANICZNE ZWIĄZKI ZAWIERAJĄCE AZOT PRZYKŁADOWE ZADANIA ORGANICZNE ZWIĄZKI ZAWIERAJĄCE AZOT Zadanie 1127 (1 pkt) Uszereguj podane związki według rosnącego ph w roztworze wodnym. Właściwy porządek podaj zapisując go wzorami półstrukturalnymi.

Bardziej szczegółowo

Pytania Egzamin Licencjacki. 1. Wyjaśnij pojęcie: szybkość reakcji enzymatycznej. Omów metodę wyznaczenia szybkości reakcji enzymatycznej.

Pytania Egzamin Licencjacki. 1. Wyjaśnij pojęcie: szybkość reakcji enzymatycznej. Omów metodę wyznaczenia szybkości reakcji enzymatycznej. Pytania Egzamin Licencjacki Międzyuczelniany Wydział Biotechnologii UG i GUMed 1. Wyjaśnij pojęcie: szybkość reakcji enzymatycznej. Omów metodę wyznaczenia szybkości reakcji enzymatycznej. 2. Wyjaśnij

Bardziej szczegółowo

Przeciwciała poliklonalne przeciwko białkom Helicobacter pylori oraz sposób ich wytwarzania. (74) Pełnomocnik:

Przeciwciała poliklonalne przeciwko białkom Helicobacter pylori oraz sposób ich wytwarzania. (74) Pełnomocnik: RZECZPOSPOLITA POLSKA Urząd Patentowy Rzeczypospolitej Polskiej (12) OPIS PATENTOWY (19) PL (11) 201982 (21) Numer zgłoszenia: 361069 (22) Data zgłoszenia: 03.07.2003 (13) B1 (51) Int.Cl. A61K 39/40 (2006.01)

Bardziej szczegółowo

(12) OPIS PATENTOWY (19) PL (11) 189078

(12) OPIS PATENTOWY (19) PL (11) 189078 RZECZPOSPOLITA POLSKA (12) OPIS PATENTOWY (19) PL (11) 189078 (13) B1 Urząd Patentowy Rzeczypospolitej Polskiej (21) Numer zgłoszenia: 328647 (22) Data zgłoszenia: 17.09.1998 (51) IntCl7 C12P 1/02 A23L

Bardziej szczegółowo

Jak pisać prace licencjackie i magisterskie

Jak pisać prace licencjackie i magisterskie 1 Jak pisać prace licencjackie i magisterskie (aktualizowane 7.03.2005) (Jeśli ktoś będzie miał jakieś uwagi na temat tego tekstu, proszę je zgłosić do dr Jadwigi Baj z Zakładu Genetyki Bakterii. Wszelkie

Bardziej szczegółowo

Analizy wielkoskalowe w badaniach chromatyny

Analizy wielkoskalowe w badaniach chromatyny Analizy wielkoskalowe w badaniach chromatyny Analizy wielkoskalowe wykorzystujące mikromacierze DNA Genotypowanie: zróżnicowane wewnątrz genów RNA Komórka eukariotyczna Ekspresja genów: Które geny? Poziom

Bardziej szczegółowo

Biologiczne oczyszczanie ścieków

Biologiczne oczyszczanie ścieków Biologiczne oczyszczanie ścieków Ściek woda nie nadająca się do użycia do tego samego celu Rodzaje ścieków komunalne, przemysłowe, rolnicze Zużycie wody na jednego mieszkańca l/dobę cele przemysłowe 4700

Bardziej szczegółowo

MIKROORGANIZMY W PRODUKCJI KOSMETYKÓW I WYBRANYCH FARMACEUTYKÓW. wykłady

MIKROORGANIZMY W PRODUKCJI KOSMETYKÓW I WYBRANYCH FARMACEUTYKÓW. wykłady MIKROORGANIZMY W PRODUKCJI KOSMETYKÓW I WYBRANYCH FARMACEUTYKÓW wykłady 1 BIOTECHNOLOGIA ANTYBIOTYKÓW 1928 r. A. Fleming penicylina ANTYBIOTYKI 1940-1944 r. S. A. Waksman aktynomycyna streptomycyna Antybiotyki

Bardziej szczegółowo

Plasmid Mini AX Gravity

Plasmid Mini AX Gravity !"# Plasmid Mini AX Gravity zestaw do izolacji ultraczystego plazmidowego DNA (plazmidy wysokokopijne) wersja 0515/I 100 izolacji Nr kat. 015-100 1 Skład zestawu Składnik Ilość Temp. Przechowywania Kolumny

Bardziej szczegółowo

Screening, klonowanie, ekspresja i oczyszczanie białek

Screening, klonowanie, ekspresja i oczyszczanie białek Screening, klonowanie, ekspresja i oczyszczanie białek Kiedy gen jest znany Dostępna sekwencja DNA sekwencjonowanie genomu, biblioteki Dostępna sekwencja białka sekwencjonowanie białka Techniki pozyskania

Bardziej szczegółowo

Suplementy. Wilkasy 2014. Krzysztof Gawin

Suplementy. Wilkasy 2014. Krzysztof Gawin Suplementy Wilkasy 2014 Krzysztof Gawin Suplementy diety - definicja Suplement diety jest środkiem spożywczym, którego celem jest uzupełnienie normalnej diety, będący skoncentrowanym źródłem witamin lub

Bardziej szczegółowo

DNA musi współdziałać z białkami!

DNA musi współdziałać z białkami! DNA musi współdziałać z białkami! Specyficzność oddziaływań między DNA a białkami wiążącymi DNA zależy od: zmian konformacyjnych wzdłuż cząsteczki DNA zróżnicowania struktury DNA wynikającego z sekwencji

Bardziej szczegółowo

Generator testów 1.3.1 Bioinformatyka_zdalne wer. 1.0.13 / 0 Strona: 1

Generator testów 1.3.1 Bioinformatyka_zdalne wer. 1.0.13 / 0 Strona: 1 Przedmiot: Bioinformatyka Nazwa testu: Bioinformatyka_zdalne wer. 1.0.13 Nr testu 0 Klasa: WNB UZ Odpowiedzi zaznaczamy TYLKO w tabeli! 1. Model Markowa substytucji aminokwasów w mutagenezie białek zakłada...

Bardziej szczegółowo

Informacje o GMO, konieczne do określenia stopnia zagrożenia.

Informacje o GMO, konieczne do określenia stopnia zagrożenia. Procedury i dokumenty wymagane do prowadzenia badań w zakresie organizmów genetycznie zmodyfikowanych Instrukcja przygotowania wniosków o wydanie zgody na zamknięte użycie GMO 1. Zamknięte użycie GMO wymaga

Bardziej szczegółowo

Wektory DNA - klonowanie molekularne

Wektory DNA - klonowanie molekularne Wektory DNA - klonowanie molekularne Fragment DNA (np. pojedynczy gen) można trwale wprowadzić do komórek gospodarza (tzn. zmusić go do powielania w tym gospodarzu) tylko wtedy, gdy zostanie on wbudowany

Bardziej szczegółowo

Zaoczne Liceum Ogólnokształcące Pegaz

Zaoczne Liceum Ogólnokształcące Pegaz WYMAGANIA EGZAMINACYJNE ROK SZKOLNY 2015/2016 Semestr jesienny TYP SZKOŁY: liceum ogólnokształcące PRZEDMIOT: biologia SEMESTR: II LICZBA GODZIN W SEMESTRZE: 15 PROGRAM NAUCZANIA: Program nauczania biologii

Bardziej szczegółowo

2015-11-18. DNA i RNA ENZYMY MODYFIKUJĄCE KOŃCE CZĄSTECZEK. DNA i RNA. DNA i RNA

2015-11-18. DNA i RNA ENZYMY MODYFIKUJĄCE KOŃCE CZĄSTECZEK. DNA i RNA. DNA i RNA Fosfataza alkaliczna CIP Calf Intestine Phosphatase- pochodzenie: jelito cielęce BAP Bacterial Alcaline Phosphatase- pochodzenie: E. coli SAP Shrimp Alcaline Phosphatase- pochodzenie: krewetki Pandalus

Bardziej szczegółowo

SPRAWOZDANIE Z BADAŃ MIKROBIOLOGICZNYCH Nr 20006/11859/09

SPRAWOZDANIE Z BADAŃ MIKROBIOLOGICZNYCH Nr 20006/11859/09 SPRAWOZDANIE MOŻE BYĆ POWIELANE TYLKO W CAŁOŚCI. INNA FORMA KOPIOWANIA WYMAGA PISEMNEJ ZGODY LABORATORIUM. SPRAWOZDANIE Z BADAŃ MIKROBIOLOGICZNYCH Nr 20006/11859/09 BADANIA WŁASNOŚCI PRZECIWDROBNOUSTROJOWYCH

Bardziej szczegółowo

Metabolizm białek. Ogólny schemat metabolizmu bialek

Metabolizm białek. Ogólny schemat metabolizmu bialek Metabolizm białek Ogólny schemat metabolizmu bialek Trawienie białek i absorpcja aminokwasów w przewodzie pokarmowym w żołądku (niskie ph ~2, rola HCl)- hydratacja, homogenizacja, denaturacja białek i

Bardziej szczegółowo

WNIOSEK O WYDANIE ZGODY NA ZAMIERZONE UWOLNIENIE GMO DO ŚRODOWISKA W CELACH INNYCH NIŻ WPROWADZENIE DO OBROTU

WNIOSEK O WYDANIE ZGODY NA ZAMIERZONE UWOLNIENIE GMO DO ŚRODOWISKA W CELACH INNYCH NIŻ WPROWADZENIE DO OBROTU WNIOSEK O WYDANIE ZGODY NA ZAMIERZONE UWOLNIENIE GMO DO ŚRODOWISKA W CELACH INNYCH NIŻ WPROWADZENIE DO OBROTU 1. Informacje o użytkowniku GMO i osobach odpowiedzialnych za przygotowanie i przeprowadzenie

Bardziej szczegółowo

Biotechnologia jest dyscypliną nauk technicznych, która wykorzystuje procesy biologiczne na skalę przemysłową. Inaczej są to wszelkie działania na

Biotechnologia jest dyscypliną nauk technicznych, która wykorzystuje procesy biologiczne na skalę przemysłową. Inaczej są to wszelkie działania na Biotechnologia jest dyscypliną nauk technicznych, która wykorzystuje procesy biologiczne na skalę przemysłową. Inaczej są to wszelkie działania na żywych organizmach prowadzące do uzyskania konkretnych

Bardziej szczegółowo

Testy aktywności przeciwdrobnoustrojowej na przykładzie metody dyfuzyjnej oraz wyznaczania wartości minimalnego stężenia hamującego wzrost.

Testy aktywności przeciwdrobnoustrojowej na przykładzie metody dyfuzyjnej oraz wyznaczania wartości minimalnego stężenia hamującego wzrost. Testy aktywności przeciwdrobnoustrojowej na przykładzie metody dyfuzyjnej oraz wyznaczania wartości minimalnego stężenia hamującego wzrost. Opracowanie: dr inż. Roland Wakieć Wprowadzenie. Najważniejszym

Bardziej szczegółowo

Materiały pochodzą z Platformy Edukacyjnej Portalu www.szkolnictwo.pl

Materiały pochodzą z Platformy Edukacyjnej Portalu www.szkolnictwo.pl Materiały pochodzą z Platformy Edukacyjnej Portalu www.szkolnictwo.pl Wszelkie treści i zasoby edukacyjne publikowane na łamach Portalu www.szkolnictwo.pl mogą byd wykorzystywane przez jego Użytkowników

Bardziej szczegółowo

Dr. habil. Anna Salek International Bio-Consulting 1 Germany

Dr. habil. Anna Salek International Bio-Consulting 1 Germany 1 2 3 Saccharomyces carlsbergensis Nowe szczepy w browarnictwie 4 Drożdże transgeniczne Saccharomyces carlsbergensis 5 6 Wśród wielu etapów produkcji piwa, proces pierwotnej i wtórnej fermentacji stwarza

Bardziej szczegółowo

protos (gr.) pierwszy protein/proteins (ang.)

protos (gr.) pierwszy protein/proteins (ang.) Białka 1 protos (gr.) pierwszy protein/proteins (ang.) cząsteczki życia materiał budulcowy materii ożywionej oraz wirusów wielkocząsteczkowe biopolimery o masie od kilku tysięcy do kilku milionów jednostek

Bardziej szczegółowo

OZNACZANIE AKTYWNOŚCI ALKALICZNEJ DIFOSFATAZY (PIROFOSFATAZY)

OZNACZANIE AKTYWNOŚCI ALKALICZNEJ DIFOSFATAZY (PIROFOSFATAZY) Ćwiczenie 8 OZNACZANIE AKTYWNOŚCI ALKALICZNEJ DIFOSFATAZY (PIROFOSFATAZY) Część doświadczalna obejmuje: - sączenie Ŝelowe ekstraktu uzyskanego z bielma niedojrzałych nasion kukurydzy - oznaczanie aktywności

Bardziej szczegółowo

Biochemia: Ćw. 11 Metoda RT-PCR

Biochemia: Ćw. 11 Metoda RT-PCR Ćwiczenie 11 METODA RT-PCR Wyciąg z kart charakterystyki substancji niebezpiecznych: bromek etydyny T+ EDTA Xi etanol, 96% F kwas octowy, 96% C -merkaptoetanol N, T Tris Xi UWAGI WSTĘPNE Praca z kwasami

Bardziej szczegółowo

ĆWICZENIE 3 DGGE- ELEKTROFOREZA W ŻELU Z GRADIENTEM CZYNNIKA DENATURUJĄCEGO

ĆWICZENIE 3 DGGE- ELEKTROFOREZA W ŻELU Z GRADIENTEM CZYNNIKA DENATURUJĄCEGO ĆWICZENIE 3 DGGE- ELEKTROFOREZA W ŻELU Z GRADIENTEM CZYNNIKA DENATURUJĄCEGO CZĘŚĆ TEORETYCZNA Metody badań i cechy w oparciu o które przeprowadzana jest klasyfikacja i identyfikacja mikroorganizmówh Struktura

Bardziej szczegółowo

Metody badania polimorfizmu/mutacji DNA. Aleksandra Sałagacka Pracownia Diagnostyki Molekularnej i Farmakogenomiki Uniwersytet Medyczny w Łodzi

Metody badania polimorfizmu/mutacji DNA. Aleksandra Sałagacka Pracownia Diagnostyki Molekularnej i Farmakogenomiki Uniwersytet Medyczny w Łodzi Metody badania polimorfizmu/mutacji DNA Aleksandra Sałagacka Pracownia Diagnostyki Molekularnej i Farmakogenomiki Uniwersytet Medyczny w Łodzi Mutacja Mutacja (łac. mutatio zmiana) - zmiana materialnego

Bardziej szczegółowo

Wprowadzenie. DNA i białka. W uproszczeniu: program działania żywego organizmu zapisany jest w nici DNA i wykonuje się na maszynie białkowej.

Wprowadzenie. DNA i białka. W uproszczeniu: program działania żywego organizmu zapisany jest w nici DNA i wykonuje się na maszynie białkowej. Wprowadzenie DNA i białka W uproszczeniu: program działania żywego organizmu zapisany jest w nici DNA i wykonuje się na maszynie białkowej. Białka: łańcuchy złożone z aminokwasów (kilkadziesiąt kilkadziesiąt

Bardziej szczegółowo

Zestaw do izolacji DNA z krwi świeżej i mrożonej

Zestaw do izolacji DNA z krwi świeżej i mrożonej DNA BLOOD KIT Nr kat. EM05 Wersja zestawu: 1.2012 Zestaw do izolacji DNA z krwi świeżej i mrożonej DNA BLOOD KIT www.dnagdansk.com Nr kat. EM05 I. PRZEZNACZENIE ZESTAWU Zestaw EXTRACTME DNA BLOOD przeznaczony

Bardziej szczegółowo

Z BADAŃ ODDZIAŁYWANIA WYBRANYCH MIKROORGANIZMÓW NA KOMPOZYTY PP Z BIOCYDEM SEANTEX

Z BADAŃ ODDZIAŁYWANIA WYBRANYCH MIKROORGANIZMÓW NA KOMPOZYTY PP Z BIOCYDEM SEANTEX SPRAWOZDANIE Z BADAŃ ODDZIAŁYWANIA WYBRANYCH MIKROORGANIZMÓW NA KOMPOZYTY PP Z BIOCYDEM SEANTEX /zlecenie 514010/ wykonane w WOJSKOWYM INSTYTUCIE CHEMII I RADIOMETRII w Warszaawie 1. Materiały i metody

Bardziej szczegółowo

1. Zamknięte użycie GMO wymaga ZGODY Ministra Środowiska na wniosek zainteresowanego użytkownika.

1. Zamknięte użycie GMO wymaga ZGODY Ministra Środowiska na wniosek zainteresowanego użytkownika. Procedury i dokumenty wymagane do prowadzenia badań w zakresie organizmów genetycznie zmodyfikowanych Instrukcja przygotowania wniosków o wydanie zgody na zamknięte użycie GMO 1. Zamknięte użycie GMO wymaga

Bardziej szczegółowo

Priony. co dobrego mówią nam drożdże? Takao Ishikawa Zakład Biologii Molekularnej Uniwersytet Warszawski

Priony. co dobrego mówią nam drożdże? Takao Ishikawa Zakład Biologii Molekularnej Uniwersytet Warszawski Priony co dobrego mówią nam drożdże? Takao Ishikawa Zakład Biologii Molekularnej Uniwersytet Warszawski Choroba Kreutzfeldta-Jakoba Pierwsze opisy pochodzą z lat 30. XX wieku Zakaźna choroba, często rodzinna

Bardziej szczegółowo

Ćwiczenie 2. Temat: Wpływ czynników fizyko-chemicznych na drobnoustroje

Ćwiczenie 2. Temat: Wpływ czynników fizyko-chemicznych na drobnoustroje Ćwiczenie 2 Temat: Wpływ czynników fizyko-chemicznych na drobnoustroje Temperatura jako czynnik wzrostowy Temperatura jest jednym z najważniejszych czynników warunkujących wzrost i procesy życiowe drobnoustrojów.

Bardziej szczegółowo

ĆWICZENIA Z BIOLOGII MOLEKULARNEJ

ĆWICZENIA Z BIOLOGII MOLEKULARNEJ UNIWERSYTET MARII CURIE-SKŁODOWSKIEJ WYDZIAŁ BIOLOGII I BIOTECHNOLOGII ZAKŁAD BIOLOGII MOLEKULARNEJ ĆWICZENIA Z BIOLOGII MOLEKULARNEJ dla studentów II roku biologii oraz III roku mikrobiologii i biotechnologii

Bardziej szczegółowo

op. = 500g 2 ampłka 100 ampułka 15

op. = 500g 2 ampłka 100 ampułka 15 L.p. EAZ.272.18.2011 Przedmiot zamówienia KALKULACJA CENY OFERTY Część I - Pożywki do oznaczania Legionella spp. Szczegółowy opis Jednostka miary Ilość Cena jednostkowa brutto [zł]** Załącznik 5 do siwz

Bardziej szczegółowo

Pasze Totally Pathogen Free

Pasze Totally Pathogen Free Pasze Totally Pathogen Free gotowe do użycia za barierą higieniczną bez konieczności autoklawowania tańsze o 30% od pasz sterylizowanych promieniowaniem Gamma Altromin - produkcja pasz tylko dla zwierząt

Bardziej szczegółowo

Zagadnienia egzaminacyjne z przedmiotu Mikrobiologia kosmetologiczna dla studentów II roku kierunku Kosmetologia

Zagadnienia egzaminacyjne z przedmiotu Mikrobiologia kosmetologiczna dla studentów II roku kierunku Kosmetologia Zagadnienia egzaminacyjne z przedmiotu Mikrobiologia kosmetologiczna dla studentów II roku kierunku Kosmetologia I. Zagadnienia omawiane na wykładach. Uzupełnieniem zagadnień omawianych na wykładach są

Bardziej szczegółowo

Przedmiot zamówienia -Specyfikacja cenowa

Przedmiot zamówienia -Specyfikacja cenowa Przedmiot zamówienia -Specyfikacja cenowa Zał nr 1 do SIWZ Grupa 1: gotowe podłoża, testy i odczynniki Podłoża na płytkach petriego o średnicy 90 mm, podłoża w probówkach,testy i odczynniki mikrobiologiczne

Bardziej szczegółowo

II. OZNACZANIE LICZBY BAKTERII Z GRUPY COLI I BAKTERII Z GRUPY COLI TYP FEKALNY METODĄ PŁYTKOWĄ W ŻYWNOŚCI I INNYCH PRODUKTACH wg PN-ISO 4832: 2007

II. OZNACZANIE LICZBY BAKTERII Z GRUPY COLI I BAKTERII Z GRUPY COLI TYP FEKALNY METODĄ PŁYTKOWĄ W ŻYWNOŚCI I INNYCH PRODUKTACH wg PN-ISO 4832: 2007 Katedra i Zakład Mikrobiologii i Wirusologii Wydział Farmaceutyczny z Oddziałem Medycyny Laboratoryjnej Mikrobiologia ogólna Biotechnologia medyczna II rok / I o Temat: Żywność jako środowisko życia mikroorganizmów.

Bardziej szczegółowo

Genetyczne modyfikowanie organizmów Kierunek OCHRONA ŚRODOWISKA, II rok semestr letni 2015/16

Genetyczne modyfikowanie organizmów Kierunek OCHRONA ŚRODOWISKA, II rok semestr letni 2015/16 Genetyczne modyfikowanie organizmów Kierunek OCHRONA ŚRODOWISKA, II rok semestr letni 2015/16 Ćwiczenie 3 Identyfikacja genetycznie modyfikowanych roślin w produktach spożywczych - jakościowe badanie obecności

Bardziej szczegółowo

Elektroforeza kwasów nukleinowych

Elektroforeza kwasów nukleinowych Elektroforeza kwasów nukleinowych Elektroforeza jest podstawową techniką wizualizacji kwasów nukleinowych pozwala bezpośrednio identyfikować cząsteczki DNA i jest stosunkowo czuła (po odpowiednim wybarwieniu

Bardziej szczegółowo