Bioinformatyka. Formaty danych - GenBank

Wielkość: px
Rozpocząć pokaz od strony:

Download "Bioinformatyka. Formaty danych - GenBank"

Transkrypt

1 Bioinformatyka Wykład 4. E. Banachowicz Zakład Biofizyki Molekularnej IF UAM Formaty danych - GenBank Poco wprowadza się dane do komputerów? 1. żeby je pobrać 2. żeby coś odkryć Jeśli baza danych nie pozwala na wyszukanie potrzebnej informacji, jest by bezużyteczna. (Nawet największa baza!) Wykład 4,

2 Formaty danych - GenBank 1. dane muszą mieć jednoznaczną strukturę i zdefiniowane powiązania 2. dane muszą być stabilne Model danych w NCBI oparty jest na sekwencji DNA (stabilność), i daje możliwość śledzenia informacji od literatury do sekwencji. Stabilność danych OMIM literatura PubMed Full Text el. Journal sekwencja DNA struktura 3D Mapy i genomy sekwencja białka Taksonomia 4 podstawowe dane Wykład 4,

3 pliki ASCII większość programów do analizy sekwencji nie akceptuje znaków spoza zestawu ASCII (różna interpretacja, problemy z transferem) Poza sekwencją DNA lub białka (raw sequence) odpowiedni format Kod DNA i białka ujednolicony został przez NC-IUB (Nomenclature Committee of the International Union of Biochemistry and Molecular Biology - Zasady/kwasy nukleinowe - ujednolicony kod NC IUP (1984) A adenozyna C cytozyna G guanina T tymidyna U urydyna R G A (puryna) Y T C (pyrymidyna) K G T (keto) M A C (amino) S G C (strong) W A T (weak) B G T C D G A T H A C T V G C A N A G C T (dowolna) - gap of indeterminate length Wykład 4,

4 Standardowy kod aminokwasów A Ala alanina P Pro prolina B Asx kw. asparaginowy/asparagina Q Gln glutamina C Cys cysteina R Arg arginina D Asp kw. asparaginowy S Ser seryna E Glu kw. glutaminowy T Thr treonina F Phe fenyloanina U selenocysteina G Gly glicyna V Val walina H His histydyna W Trp tryptofan I Ile izoleucyna Y Tyr tyrozyna K Lys lizyna Z Glx kw.glutaminowy/glutamina L Leu leucyna X Xxx dowolny M Met metionina * stop translacji N Asn asparagina - gap of indeterminate length Abstract Syntax Notation Sequence Format ASN.1 ASN.1 (skrót od Abstract Syntax Notation One abstrakcyjna notacja składniowa numer jeden) język opisu danych przejęty i rozwijany przez NCBI Wykład 4,

5 Integracja danych z wielu różnych źródeł np. PubMed (np. wyszukiwanie według autorów) MEDLINE Display Tag Name AB Abstract AD Affiliation AID Article Identifier AU Author CI Copyright Information CIN Comment In CN Corporate Author CON Comment On CRF Corrected and republished from CRI Corrected and republished in DA Date Created DCOM Date Completed DEP Date of Electronic Publication DP Publication Date EDAT Entrez Date EFR Erratum For EIN Erratum In FAU Full Author Name FIR Full Investigator FPS Full Personal Name as Subject GN General Note GR Grant Number GS Gene Symbol IP Issue IR Investigator IRAD Investigator Affiliation IS ISSN JID NLM Unique ID JT Full Journal Title LA Language LID Location ID LR MH MHDA OAB OCI OID ORI OT OTO OWN PG PHST PL PMID PRIN PROF PS PST PT PUBM RF RIN RN ROF RPF RPI SB SFM SI SO SPIN STAT TA TI TT UIN UOF VI Last Revision Date MeSH Terms MeSH Date Other Abstract Other Copyright Information Other ID Original Report In Other Term Other Term Owner Owner Pagination Publication History Status Date Place of Publication PubMed Unique Identifier Partial Retraction In Partial Retraction Of Personal Name as Subject Publication Status Publication Type Publishing Model Number of References Retraction In EC/RN Number Retraction Of Republished From Republished In Subset Space Flight Mission Secondary Source Identifier Source Summary For Patients In Status Tag Journal Title Abbreviation Title Transliterated Title Update In Update Of Volume Wykład 4,

6 cytowanie streszczenie brak streszczenia dostępny w PMC autorzy dostępny pełen teskt identyfikator czasopismo data publikacji nr stron tytuł Seq-id klasa obiektów DDBJ/GenBank/EMBL Podobna struktura i identyfikatory: A12345=A12345 PIR/ Swiss-Prot Różne identyfikatory: A12345 A12345 Wykład 4,

7 GenBank: nazwa lokusa (locus) długość i typ sekwencji klasyfikacja organizmu data wprowadzenia nazwa lokusa (locus) długość i typ sekwencji klasyfikacja organizmu data wprowadzenia Wykład 4,

8 GenBank: opis objektu ACCESSION numer dostępu do oryginalnego źródła VERSION numer kolejnej wersji KEYWORDS słowa kluczowe (cross reference) SOURCE organizm, z którego pochodziło DNA ORGANISM opis organizmu REFERENCE bibliografia GenBank: COMMENT np.funkcja biologiczna FEATURES informacje o sekwencji przez podanie położenia zasad lub przedziału położeń sourece, misc_signal, mrna, CDS, intron, mutation ORIGIN początek sekwencji // koniec sekwencji Wykład 4,

9 EMBL: European Molecular Biology Laboratory Wygląd strony w 2006 Wykład 4,

10 EMBL: European Molecular Biology Laboratory ID numer identyfikacyjny w bazie danych AC numer dostępowy do pierwotnej sekwencji SV wersja DT data wprowadzenia lub modyfikacji DE opis OS,OC organizm pochodzenia DNA RN (RP, RA, RT, RL, ) bibliografia FH, FT informacje o sekwencji (FEATUREs) SQ, // - początek i koniec sekwencji Wykład 4,

11 Format sekwencji FASTA >embl DQ DQ Influenza A virus (A/Cygnus olor/astrakhan/ast /2005(H5N1)) polymerase basic protein 1 (PB1) gene, complete cds.... caaaccatttgaatggatgtcaatccgactttacttttcttgaaagtaccagtgcaaaat gctataagtaccacattcccttatactggagaccctccatacagccatgggacagggaca ggatacaccatggacacagtcaacagaacacaccaatattcagaaaaggggaagtggaca acaaacacagagactggagcaccccaactcaacccgattgatggaccactacctgaggat aatgagcccagtggttatgcacaaacagattgtgtattggaagcaatggctttccttgaa gaatcccacccagggatctttgaaaactcgtgtcttgaaacgatggaaattgttcaacaa acaagagtggataaactgacccaaggtcgtcagacctatgactggacattgaatagaaac >gi gb ABD polymerase basic protein 1 [Influenza A virus (A/Cygnus olor/astrakhan/ast05-2- caaccggctgcaaccgctttggccaacactatagaaatcttcagatcgaacggtctaaca 10/2005(H5N1))] gccaatgaatcgggacggctaatagatttcctcaaggatgtgatggaatcaatggataag MDVNPTLLFLKVPVQNAISTTFPYTGDPPYSHGTGTGYTMDTVNRTHQYSEKGKWTTNTETGAPQLNPID gaagaaatggagataacaacacacttccagagaaagagaagagtgagagacaacatgacc GPLPEDNEPSGYAQTDCVLEAMAFLEESHPGIFENSCLETMEIVQQTRVDKLTQGRQTYDWTLNRNQPAA aaaaagatggtcacacaaagaacaatagggaagaaaaagcaaaggctgaacaaaaagagc TALANTIEIFRSNGLTANESGRLIDFLKDVMESMDKEEMEITTHFQRKRRVRDNMTKKMVTQRTIGKKKQ tacctgataagagcactgacactgaatacaatgacaaaagatgcagaaagaggcaaattg RLNKKSYLIRALTLNTMTKDAERGKLKRRAIATPGMQIRGFVYFVETLARSICEKLEQSGLPVGGNEKKA KLANVVRKMMTNSQDTELSFTITGDNTKWNENQNPRMFLAMITYITRNQPEWFRNVLSIAPIMFSNKMAR aagaggcgagcaattgcaacacccggaatgcaaatcagaggattcgtgtactttgttgaa LGRGYMFESKSMKLRTQIPAEMLANIDLKYFNELTKKKIEKIRPLLIDGTASLSPGMMMGMFNMLSTVLG acattagcgaggagtatctgtgagaaacttgagcaatctggactcccagttggagggaat VSILNLGQKRYTKTTYWWDGLQSSDDFALIVNAPNHEGIQAGVDRFYRTCKLVGINMSKKKSYINRTGTF gaaaagaaggctaaattggcaaacgtcgtgaggaagatgatgactaactcacaagatact EFTSFFYRYGFVANFSMELPSFGVSGINESADMSIGVTVIKNNMINNDLGPATAQMALQLFIKDYRYTYR gaactctcctttacaattactggagacaatactaaatggaatgagaatcagaatcctagg CHRGDTQIQTRRSFELKKLWEQTRSKAGLLVSDGGPNLYNIRNLHIPEVCLKWELMDEDYQGRLCNPLNP FVSHKEIESVNNAVVMPAHGPAKGMEYDAVATTHSWIPKRNRSILNTSQRGILEDEQMYQKCCNLFEKFF PSSSYRRPVGISSMVEAMVSRARIDARIDFESGRIKKEEFAEIMKICSTIEELRRPK > jednoliniowy opis wszystkie linie tekstu nie powinny być dłuższe niż 80 znaków Wykład 4,

12 NBRF/PIR (National Biomedical Research Foundation/Protein Information Resource >P1;gi gb ABD64049_1 gi gb ABD64049_1 757 bases MDVNPTLLFL KVPVQNAIST TFPYTGDPPY SHGTGTGYTM DTVNRTHQYS EKGKWTTNTE TGAPQLNPID GPLPEDNEPS GYAQTDCVLE AMAFLEESHP GIFENSCLET MEIVQQTRVD KLTQGRQTYD WTLNRNQPAA TALANTIEIF RSNGLTANES GRLIDFLKDV MESMDKEEME ITTHFQRKRR VRDNMTKKMV TQRTIGKKKQ RLNKKSYLIR ALTLNTMTKD AERGKLKRRA IATPGMQIRG READSEQ konwersja formatów Wykład 4,

13 znane formaty sekwencji ID Name Read Write Int'leaf Features Sequence Content-type Suffix 1 GenBank gb yes yes -- yes yes biosequence/genbank.gb 2 EMBL em yes yes -- yes yes biosequence/embl.embl 3 Pearson Fasta fa yes yes yes biosequence/fasta.fasta 4 GCG yes yes yes biosequence/gcg.gcg 5 MSF yes yes yes -- yes biosequence/msf.msf 6 Clustal yes yes yes -- yes biosequence/clustal.aln 7 NBRF yes yes yes biosequence/nbrf.nbrf 8 PIR CODATA yes yes yes biosequence/codata.pir 9 ACEDB yes yes yes biosequence/acedb.ace 10 Phylip3.2 yes yes yes -- yes biosequence/phylip2.phylip2 11 Phylip Phylip4 yes yes yes -- yes biosequence/phylip.phylip 12 Plain Raw yes yes yes biosequence/plain.seq 13 PAUP NEXUS yes yes yes -- yes biosequence/nexus.nexus 14 XML yes yes -- yes yes biosequence/xml.xml 15 FlatFeat FFF yes yes -- yes -- biosequence/fff.fff 16 GFF yes yes -- yes -- biosequence/gff.gff 17 BLAST yes -- yes -- yes biosequence/blast.blast 18 Pretty -- yes yes -- yes biosequence/pretty.pretty 19 SCF yes yes biosequence/scf.scf 20 DNAStrider yes yes yes biosequence/strider.strider 21 IG Stanford yes yes yes biosequence/ig.ig 22 Fitch yes biosequence/fitch.fitch 23 ASN yes biosequence/asn1.asn Anatomia danych SwissProt/TrEMBL Wykład 4,

14 Wykład 4,

15 MeCP2 NCBI b=protein&val= EMBL-EBI PIR ReadSeq PDB Wykład 4,

16 plik PDB plik PDB Wykład 4,

17 plik PDB plik PDB Ser Lys Val Wykład 4,

18 plik PDB Identyfikacja sekwencji w BD Identyfikacja przez porównanie z innymi sekwencjami Zestawienia sekwencji = uliniowienie = =porównanie = alignment Wykład 4,

19 Porównywanie sekwencji Pierwsze pytanie biologa molekularnego, kiedy odkryje nową sekwencję: Czy w bazie sekwencji są już sekwencje podobne do mojej? sekwencje są identyczne nic nowego. sekwencja jest podobna (ma krewnych ) nowy członek znanej rodziny sekwencja ma kilka podobnych regionów, motywów lub domen można zaproponować funkję Nie ma znaczącego podobieństwa dużo pracy.. Porównywanie sekwencji Celem porównania białek jest między innymi przypisanie informacji znanej dla jednej cząsteczki drugiej cząsteczce Wykład 4,

20 Pokrycie sekwencji dopasowanie globalne dopasowanie wzdłuż całej sekwencji (zastosowanie: do białek składających się z pojedynczej domeny lub homologicznych słabo zróżnicowanych) dopasowanie lokalne uwzględnia domenową naturę białek, szuka subsekwencji (zastosowanie: do białek wielodomenowych, mrna z sekwencją genomową) 39 BLAST Wykład 4,

21 Wykład 4,

22 CDN....na ćwiczeniach Wykład 4,

Bioinformatyka. Michał Bereta mbereta@pk.edu.pl www.michalbereta.pl

Bioinformatyka. Michał Bereta mbereta@pk.edu.pl www.michalbereta.pl Bioinformatyka Michał Bereta mbereta@pk.edu.pl www.michalbereta.pl 1 Bazy danych biologicznych Bazy danych sekwencji nukleotydowych Pierwotne bazy danych (ang. primary database) Wykorzystywane do zbierania

Bardziej szczegółowo

Bioinformatyka. z sylabusu...

Bioinformatyka. z sylabusu... Bioinformatyka Wykład 1. E. Banachowicz Zakład Biofizyki Molekularnej IF UAM http://www.amu.edu.pl/~ewas z sylabusu... Wykład 1, 2008 1 Co to jest Bioinformatyka? Zastosowanie technologii informacji do

Bardziej szczegółowo

Podstawy bioinformatyki - biologiczne bazy danych

Podstawy bioinformatyki - biologiczne bazy danych Podstawy bioinformatyki - biologiczne bazy danych Czym jest bioinformatyka? Bioinformatyka Bioinformatyka jest interdyscyplinarną dziedziną nauki obejmującą wykorzystanie metod obliczeniowych do badania

Bardziej szczegółowo

Bioinformatyka Laboratorium, 30h. Michał Bereta mbereta@pk.edu.pl www.michalbereta.pl

Bioinformatyka Laboratorium, 30h. Michał Bereta mbereta@pk.edu.pl www.michalbereta.pl Laboratorium, 30h Michał Bereta mbereta@pk.edu.pl www.michalbereta.pl Zasady zaliczenia przedmiotu Kolokwia (3 4 ) Ocena aktywności i przygotowania Obecnośd Literatura, materiały Bioinformatyka i ewolucja

Bardziej szczegółowo

EWOLUCJA GENOMÓW. Bioinformatyka, wykład 6 (22.XI.2010) krzysztof_pawlowski@sggw.pl

EWOLUCJA GENOMÓW. Bioinformatyka, wykład 6 (22.XI.2010) krzysztof_pawlowski@sggw.pl EWOLUCJA GENOMÓW Bioinformatyka, wykład 6 (22.XI.2010) krzysztof_pawlowski@sggw.pl Wykład 6 spis treści genomika mapowanie genomów początki ewolucji świat RNA świat wirusów (?) ewolucja genomów GENOMIKA

Bardziej szczegółowo

Związki biologicznie aktywne

Związki biologicznie aktywne Związki biologicznie aktywne Tematyka wykładów 1. Chemia związków biologicznie aktywnych pojęcia ogólne, klasyfikacja leków. 2. Związki biologicznie aktywne jako związki pochodzenia naturalnego, półsyntetycznego

Bardziej szczegółowo

protos (gr.) pierwszy protein/proteins (ang.)

protos (gr.) pierwszy protein/proteins (ang.) Białka 1 protos (gr.) pierwszy protein/proteins (ang.) cząsteczki życia materiał budulcowy materii ożywionej oraz wirusów wielkocząsteczkowe biopolimery o masie od kilku tysięcy do kilku milionów jednostek

Bardziej szczegółowo

Budowa i funkcje białek

Budowa i funkcje białek Budowa i funkcje białek Białka Wszystkie organizmy zawierają białko Każdy organizm wytwarza własne białka Podstawowe składniki białek - aminokwasy Roślinne mogą wytwarzać aminokwasy ze związków nieorganicznych

Bardziej szczegółowo

ETYKIETA. Fitmax Easy GainMass proszek

ETYKIETA. Fitmax Easy GainMass proszek ETYKIETA Fitmax Easy GainMass proszek smak waniliowy, truskawkowy, czekoladowy Środek spożywczy zaspokajający zapotrzebowanie organizmu przy intensywnym wysiłku fizycznym, zwłaszcza sportowców. FitMax

Bardziej szczegółowo

Skrypt Bioinformatyka DRAFT Strona 25

Skrypt Bioinformatyka DRAFT Strona 25 Spis treści 4 Budowa aminokwasów i białek... 26 4.1 Ogólna budowa aminokwasów... 26 4.2 Kalkulator własności fizykochemicznych białka... 40 4.3 Metody analizy własności aminokwasów... 44 4.3.1 Metoda Analizy

Bardziej szczegółowo

Spis treści. Przedmowa... XI. Wprowadzenie i biologiczne bazy danych. 1 Wprowadzenie... 3. 2 Wprowadzenie do biologicznych baz danych...

Spis treści. Przedmowa... XI. Wprowadzenie i biologiczne bazy danych. 1 Wprowadzenie... 3. 2 Wprowadzenie do biologicznych baz danych... Przedmowa... XI Część pierwsza Wprowadzenie i biologiczne bazy danych 1 Wprowadzenie... 3 Czym jest bioinformatyka?... 5 Cele... 5 Zakres zainteresowań... 6 Zastosowania... 7 Ograniczenia... 8 Przyszłe

Bardziej szczegółowo

Bioinformatyka. (wykład monograficzny) wykład 5. E. Banachowicz. Zakład Biofizyki Molekularnej IF UAM

Bioinformatyka. (wykład monograficzny) wykład 5. E. Banachowicz. Zakład Biofizyki Molekularnej IF UAM Bioinformatyka (wykład monograficzny) wykład 5. E. Banachowicz Zakład Biofizyki Molekularnej IF UM http://www.amu.edu.pl/~ewas lgorytmy macierze punktowe (DotPlot) programowanie dynamiczne metody heurystyczne

Bardziej szczegółowo

Wykład 10 2008-04-30. Bioinformatyka. Wykład 9. E. Banachowicz. Zakład Biofizyki Molekularnej IF UAM

Wykład 10 2008-04-30. Bioinformatyka. Wykład 9. E. Banachowicz. Zakład Biofizyki Molekularnej IF UAM Bioinformatyka Wykład 9 E. Banachowicz Zakład Biofizyki Molekularnej IF UAM http://www.amu.edu.pl/~ewas 1 Konsekwencje zestawieo wielu sekwencji - rodziny białkowe, domeny, motywy i wzorce 2 Bioinformatyka,

Bardziej szczegółowo

Generator testów 1.3.1 Bioinformatyka_zdalne wer. 1.0.13 / 0 Strona: 1

Generator testów 1.3.1 Bioinformatyka_zdalne wer. 1.0.13 / 0 Strona: 1 Przedmiot: Bioinformatyka Nazwa testu: Bioinformatyka_zdalne wer. 1.0.13 Nr testu 0 Klasa: WNB UZ Odpowiedzi zaznaczamy TYLKO w tabeli! 1. Model Markowa substytucji aminokwasów w mutagenezie białek zakłada...

Bardziej szczegółowo

INSTRUKCJA TECHNICZNA - Komputerowy Program żywieniowy DietaPro.pl WPROWADZANIE DANYCH O PACJENCIE. okno: NUTRITION/WYWIADY

INSTRUKCJA TECHNICZNA - Komputerowy Program żywieniowy DietaPro.pl WPROWADZANIE DANYCH O PACJENCIE. okno: NUTRITION/WYWIADY INSTRUKCJA TECHNICZNA - Komputerowy Program żywieniowy DietaPro.pl W celu rozpoczęcia pracy z programem należy się zalogować standardowe hasło programu to admin możliwość wprowadzenia własnego hasła poprzez

Bardziej szczegółowo

Bioinformatyka. Wykład 2 (12.X.2010) I r. studiów magisterskich, biologia (SGGW) Krzysztof Pawłowski

Bioinformatyka. Wykład 2 (12.X.2010) I r. studiów magisterskich, biologia (SGGW) Krzysztof Pawłowski Bioinformatyka Wykład 2 (12.X.2010) I r. studiów magisterskich, biologia (SGGW) Krzysztof Pawłowski tydzień temu Co to jest bioinformatyka Sekwencjonowanie genomów historia Metagenomika Wykład 2 spis treści

Bardziej szczegółowo

PODSTAWY BIOINFORMATYKI 8 DOPASOWYWANIE SEKWENCJI AMINOKWASÓW

PODSTAWY BIOINFORMATYKI 8 DOPASOWYWANIE SEKWENCJI AMINOKWASÓW PODSTAWY BIOINFORMATYKI 8 DOPASOWYWANIE SEKWENCJI AMINOKWASÓW DOPASOWYWANIE SEKWENCJI 1. Miary podobieństwa sekwencji aminokwasów 2. Zastosowanie programów: CLUSTAL OMEGA BLAST Copyright 2013, Joanna Szyda

Bardziej szczegółowo

Księgarnia PWN: A.D. Baxevanis, B.F.F. Ouellette Bioinformatyka

Księgarnia PWN: A.D. Baxevanis, B.F.F. Ouellette Bioinformatyka Księgarnia PWN: A.D. Baxevanis, B.F.F. Ouellette Bioinformatyka Słowo wstępne XIII Przedmowa XV 1. Bioinformatyka i Internet Andreas D. Baxevanis 1 1.1. Podstawy Internetu 2 1.2. Połączenie z Internetem

Bardziej szczegółowo

BIOLOGICZNE BAZY DANYCH SYLABUS

BIOLOGICZNE BAZY DANYCH SYLABUS BIOLOGICZNE BAZY DANYCH SYLABUS Elementy składowe sylabusu Nazwa jednostki prowadzącej kierunek Nazwa kierunku studiów Poziom kształcenia Profil studiów Forma studiów Kod Język Rodzaj Rok studiów /semestr

Bardziej szczegółowo

Przewodnik Użytkownika systemu POL-index. Opis formatu POL-index

Przewodnik Użytkownika systemu POL-index. Opis formatu POL-index Przewodnik Użytkownika systemu POL-index Opis formatu POL-index Opis formatu POL-index UWAGA: ze względu na krótki termin, jaki upłynął od komunikatu Ministra Nauki i Szkolnictwa Wyższego uruchamiający

Bardziej szczegółowo

1.1. AMINOKWASY BIAŁKOWE

1.1. AMINOKWASY BIAŁKOWE 1 ĆWICZENIE 1 BUDOWA I WŁAŚCIWOŚCI AMINOKWASÓW 1.1. AMINOKWASY BIAŁKOWE Aminokwasy są związkami organicznymi zawierającymi co najmniej jedną grupę karboksylową -COOH oraz co najmniej jedną grupę aminową

Bardziej szczegółowo

BUDOWA I WŁAŚCIWOŚCI AMINOKWASÓW. 1.1. Aminokwasy białkowe

BUDOWA I WŁAŚCIWOŚCI AMINOKWASÓW. 1.1. Aminokwasy białkowe BUDOWA I WŁAŚCIWOŚCI AMINOKWASÓW 1.1. Aminokwasy białkowe Aminokwasy są związkami organicznymi, zawierającymi co najmniej jedną grupę karboksylową COOH oraz co najmniej jedną grupę aminową NH 2. W zależności

Bardziej szczegółowo

Analiza danych pochodzących z sekwencjonowania nowej generacji - przyrównanie do genomu referencyjnego. - część I -

Analiza danych pochodzących z sekwencjonowania nowej generacji - przyrównanie do genomu referencyjnego. - część I - pochodzących z sekwencjonowania nowej generacji - przyrównanie do genomu referencyjnego - część I - Katedra Genetyki Uniwersytet Przyrodniczy we Wrocławiu Plan wykładów --------------------------------------------------------

Bardziej szczegółowo

Statystyczna analiza danych

Statystyczna analiza danych Statystyczna analiza danych ukryte modele Markowa, zastosowania Anna Gambin Instytut Informatyki Uniwersytet Warszawski plan na dziś Ukryte modele Markowa w praktyce modelowania rodzin białek multiuliniowienia

Bardziej szczegółowo

Białko w diecie sportowca

Białko w diecie sportowca Białko w diecie sportowca mgr. Joanna Misiorowska 1 mgr.joanna Misiorowska "Żywienie w sporcie" Białko na piedestale od zarania dziejów Dieta mięsna: połowa V wieku p. n. e. Model diety wysokobiałkowej

Bardziej szczegółowo

Pasze Totally Pathogen Free

Pasze Totally Pathogen Free Pasze Totally Pathogen Free gotowe do użycia za barierą higieniczną bez konieczności autoklawowania tańsze o 30% od pasz sterylizowanych promieniowaniem Gamma Altromin - produkcja pasz tylko dla zwierząt

Bardziej szczegółowo

Metabolizm białek. Ogólny schemat metabolizmu bialek

Metabolizm białek. Ogólny schemat metabolizmu bialek Metabolizm białek Ogólny schemat metabolizmu bialek Trawienie białek i absorpcja aminokwasów w przewodzie pokarmowym w żołądku (niskie ph ~2, rola HCl)- hydratacja, homogenizacja, denaturacja białek i

Bardziej szczegółowo

EWOLUCJA GENOMÓW. Bioinformatyka, wykład 7 (29.XI.2010) krzysztof_pawlowski@sggw.pl

EWOLUCJA GENOMÓW. Bioinformatyka, wykład 7 (29.XI.2010) krzysztof_pawlowski@sggw.pl EWOLUCJA GENOMÓW Bioinformatyka, wykład 7 (29.XI.2010) krzysztof_pawlowski@sggw.pl Wykład 7 spis treści świat wirusów (?) ewolucja genomów GENOMIKA badanie struktury i funkcjonowania genomów GENOMIKA STRUKTURALNA

Bardziej szczegółowo

WEB OF SCIENCE Wyszukiwanie cytowanych pozycji bibliograficznych Cited Reference Search

WEB OF SCIENCE Wyszukiwanie cytowanych pozycji bibliograficznych Cited Reference Search WEB OF SCIENCE Wyszukiwanie cytowanych pozycji bibliograficznych Cited Reference Search DR KLEMENTYNA KARLIŃSKA-BATRES Na czym polega wyszukiwanie cytowanych pozycji bibliograficznych? Zaczynamy od znanej

Bardziej szczegółowo

Rewolucja kolagenowa

Rewolucja kolagenowa Rewolucja kolagenowa Kolagen Najważniejsze białko ludzkiego organizmu Podstawowy budulec: skóry, paznokci, włosów, ścięgien, kości, stawów, chrząstek, rogówki oka, naczyń krwionośnych i limfatycznych Fundament

Bardziej szczegółowo

V Ogólnopolska Konferencja Naukowa ZARZĄDZANIE INFORMACJĄ W NAUCE

V Ogólnopolska Konferencja Naukowa ZARZĄDZANIE INFORMACJĄ W NAUCE V Ogólnopolska Konferencja Naukowa ZARZĄDZANIE INFORMACJĄ W NAUCE Katowice, 27 28 listopada 2014 Spis treści: 1. Informacje ogólne 2. Czasopisma w MathSciNet 3. Jednoznaczna identyfikacja autorów 4. System

Bardziej szczegółowo

Materiały pochodzą z Platformy Edukacyjnej Portalu www.szkolnictwo.pl

Materiały pochodzą z Platformy Edukacyjnej Portalu www.szkolnictwo.pl Materiały pochodzą z Platformy Edukacyjnej Portalu www.szkolnictwo.pl Wszelkie treści i zasoby edukacyjne publikowane na łamach Portalu www.szkolnictwo.pl mogą byd wykorzystywane przez jego Użytkowników

Bardziej szczegółowo

Krok 3: Przeszukiwanie baz projektów europejskich

Krok 3: Przeszukiwanie baz projektów europejskich Zbadaj innowacyjność swojego pomysłu badawczego Krok 3: Przeszukiwanie baz projektów europejskich Angelika Łysiak Regionalne Centrum Innowacji i Transferu Technologii Zachodniopomorski Uniwersytet Technologiczny

Bardziej szczegółowo

AMINOKWASY BUDOWA I WŁAŚCIWOŚCI BIAŁKA BUDOWA I FUNKCJE

AMINOKWASY BUDOWA I WŁAŚCIWOŚCI BIAŁKA BUDOWA I FUNKCJE Ćwiczenie 1 AMINOKWASY BUDOWA I WŁAŚCIWOŚCI BIAŁKA BUDOWA I FUNKCJE Część doświadczalna obejmuje: rozdział aminokwasów metodą chromatografii podziałowej (technika chromatografii bibułowej wstępującej)

Bardziej szczegółowo

Przykład Najlepszym sposobem zilustrowania zintegrowanej natury systemu Entrez jest porównanie dwóch przykładów biologicznych z uŝyciem wersji WWW

Przykład Najlepszym sposobem zilustrowania zintegrowanej natury systemu Entrez jest porównanie dwóch przykładów biologicznych z uŝyciem wersji WWW Przykład Najlepszym sposobem zilustrowania zintegrowanej natury systemu Entrez jest porównanie dwóch przykładów biologicznych z uŝyciem wersji WWW Entrez jako interfejsu. Najprostszym sposobem przeszukiwania

Bardziej szczegółowo

Narzędzie do analizy sekwencji BLAST

Narzędzie do analizy sekwencji BLAST Narzędzie do analizy sekwencji BLAST (Rozdział 16) Streszczenie Porównanie sekwencji nukleotydów lub białek tych samych lub różnych organizmów jest bardzo potężnym narzędziem w biologii molekularnej. Poprzez

Bardziej szczegółowo

Historia Bioinformatyki

Historia Bioinformatyki Historia Bioinformatyki 1859 Darwin i Wallace opublikowali O powstaniu gatunku 1865 Mendel eksperymentując z grochem, wykazuje, że cechy dziedziczą się w odrębnych jednostkach 1869 Meischer wyizolował

Bardziej szczegółowo

Sygnalizacja_Damian_Szymon / PLC_1 [CPU 1214C DC/DC/DC] / Program blocks

Sygnalizacja_Damian_Szymon / PLC_1 [CPU 1214C DC/DC/DC] / Program blocks Sygnalizacja_Damian_Szymon / PLC_1 [CPU 1214C DC/DC/DC] / Program blocks Main [OB1] Main Properties General Name Main Number 1 Type Language LAD Information Title "Main Program Sweep (Cycle)" Author Family

Bardziej szczegółowo

Od jakiego pułapu startujemy? matematyka

Od jakiego pułapu startujemy? matematyka dla biotechnologów Wykład 2 Definicja bioinformatyki Od jakiego pułapu startujemy? Zakładamy, że te pojęcia są w małym palcu: DNA, RNA struktura, funkcje, rodzaje Genom Białka struktury, funkcje, rodzaje,

Bardziej szczegółowo

Samouczek: Konstruujemy drzewo

Samouczek: Konstruujemy drzewo ROZDZIAŁ 2 Samouczek: Konstruujemy drzewo Po co nam drzewa filogenetyczne? Drzewa filogenetyczne często pojawiają się dzisiaj w pracach z dziedziny biologii molekularnej, które nie mają związku z filogenetyką

Bardziej szczegółowo

Generowanie struktury trójwymiarowej białka dla zadanych wartości katow dwuściennych Phi, Psi.

Generowanie struktury trójwymiarowej białka dla zadanych wartości katow dwuściennych Phi, Psi. Wydział Fizyki i Informatyki Stosowanej Praca inżynierska Zbigniew Baster kierunek studiów: Fizyk Medyczna Generowanie struktury trójwymiarowej białka dla zadanych wartości katow dwuściennych Phi, Psi.

Bardziej szczegółowo

Oddziaływanie leków z celami molekularnymi i projektowanie leków

Oddziaływanie leków z celami molekularnymi i projektowanie leków Oddziaływanie leków z celami molekularnymi i projektowanie leków Prof. dr hab. Sławomir Filipek Grupa BIOmodelowania (biomodellab.eu) Uniwersytet Warszawski, Wydział Chemii oraz Centrum Nauk Biologiczno-Chemicznych

Bardziej szczegółowo

ISBN 978-83-89244-90-1

ISBN 978-83-89244-90-1 ISBN 978-83-89244-90-1 9 788389 244901 Notka biograficzna Aleksandra Gruca jest inżynierem, bioinformatykiem. Od początku swojej pracy naukowej koncentruje się na zagadnieniach związanych z zastosowaniem

Bardziej szczegółowo

Elementy bioinformatyki. Aminokwasy, białka, receptory. Andrzej Bąk Instytut Chemii UŚ chemoinformatyka wykład 1

Elementy bioinformatyki. Aminokwasy, białka, receptory. Andrzej Bąk Instytut Chemii UŚ chemoinformatyka wykład 1 Elementy bioinformatyki. Aminokwasy, białka, receptory Andrzej Bąk Instytut Chemii UŚ chemoinformatyka wykład 1 Tematy istoria odkrywania białek Budowa białek Budowa aminokwasów Właściwości aminokwasów

Bardziej szczegółowo

Ł Ź Ą Ż Ż Ź Ł Ż Ć Ć Ż Ż ć Ź Ż Ż Ż Ć Ż Ć ź ć Ż ż ż Ż Ż ć Ż ż Ż Ż Ż ć Ż ż ć Ć ź Ą Ż Ż ż ć Ź Ż ż Ą Ą Ż ć Ź ź Ż ź ć Ą ć ć ż ż ź ź ć ć ż ż ż ź ć ć Ą ż Ą ż ż Ż Ż Ż ć ż Ż ć ż Ł Ż Ą Ż ź ż ć Ż Ż Ż Ć Ź Ź Ż Ą ć

Bardziej szczegółowo

BIOINFORMATYKA. edycja 2015. wykład 2 BAZY DANYCH. dr Jacek Śmietański jacek.smietanski@ii.uj.edu.pl http://jaceksmietanski.net.

BIOINFORMATYKA. edycja 2015. wykład 2 BAZY DANYCH. dr Jacek Śmietański jacek.smietanski@ii.uj.edu.pl http://jaceksmietanski.net. BIOINFORMATYKA edycja 2015 wykład 2 BAZY DANYCH dr Jacek Śmietański jacek.smietanski@ii.uj.edu.pl http://jaceksmietanski.net slajd 1 Tło: mioglobina Myoglobin was the first protein visualized in three

Bardziej szczegółowo

Wykład Bioinformatyka 2012-09-24. Bioinformatyka. Wykład 7. E. Banachowicz. Zakład Biofizyki Molekularnej IF UAM. Ewolucyjne podstawy Bioinformatyki

Wykład Bioinformatyka 2012-09-24. Bioinformatyka. Wykład 7. E. Banachowicz. Zakład Biofizyki Molekularnej IF UAM. Ewolucyjne podstawy Bioinformatyki Bioinformatyka Wykład 7 E. Banachowicz Zakład Biofizyki Molekularnej IF UAM http://www.amu.edu.pl/~ewas 1 Plan Bioinformatyka Ewolucyjne podstawy Bioinformatyki Filogenetyka Bioinformatyczne narzędzia

Bardziej szczegółowo

RAPORT Z WYKONANIA MAP ZAGROZ ENIA POWODZIOWEGO I MAP RYZYKA POWODZIOWEGO ZAŁĄCZNIK NR 5

RAPORT Z WYKONANIA MAP ZAGROZ ENIA POWODZIOWEGO I MAP RYZYKA POWODZIOWEGO ZAŁĄCZNIK NR 5 Projekt: Informatyczny system osłony kraju przed nadzwyczajnymi zagrożeniami Nr Projektu: POIG.07.01.00 00 025/09 RAPORT Z WYKONANIA MAP ZAGROZ ENIA POWODZIOWEGO I MAP RYZYKA POWODZIOWEGO ZAŁĄCZNIK NR

Bardziej szczegółowo

Podstawy genetyki. Genetyka to dział biologii, analizujący problemy związane z dziedziczeniem cech i zmiennością organizmów.

Podstawy genetyki. Genetyka to dział biologii, analizujący problemy związane z dziedziczeniem cech i zmiennością organizmów. R o z d z i a ł 1 Podstawy genetyki Genetyka w medycynie W ostatnich dziesięcioleciach dokonał się znaczny postęp w zrozumieniu, jaką rolę odgrywają czynniki dziedziczne w procesach patologii człowieka.

Bardziej szczegółowo

The Dublin Core Metadata Element Set, Ver. 1.1 a potrzeby i oczekiwania bibliotekarzy cyfrowych - analiza przypadków

The Dublin Core Metadata Element Set, Ver. 1.1 a potrzeby i oczekiwania bibliotekarzy cyfrowych - analiza przypadków The Dublin Core Metadata Element Set, Ver. 1.1 a potrzeby i oczekiwania bibliotekarzy cyfrowych - analiza przypadków Joanna Potęga Biblioteka Narodowa Agnieszka Wróbel Biblioteka Uniwersytecka w Warszawie

Bardziej szczegółowo

Przyrównywanie sekwencji

Przyrównywanie sekwencji Instytut Informatyki i Matematyki Komputerowej UJ, opracowanie: mgr Ewa Matczyńska, dr Jacek Śmietański Przyrównywanie sekwencji 1. Porównywanie sekwencji wprowadzenie Sekwencje porównujemy po to, aby

Bardziej szczegółowo

ANALIZA KODUJĄCEJ SEKWENCJI NUKLEOTYDOWEJ GENU α A -GLOBINY GOŁĘBIA DOMOWEGO (COLUMBA LIVIA VAR. DOMESTICA) ORAZ SIERPÓWKI (STREPTOPELIA DECAOCTO)

ANALIZA KODUJĄCEJ SEKWENCJI NUKLEOTYDOWEJ GENU α A -GLOBINY GOŁĘBIA DOMOWEGO (COLUMBA LIVIA VAR. DOMESTICA) ORAZ SIERPÓWKI (STREPTOPELIA DECAOCTO) Acta Sci. Pol., Zootechnica 8 (4) 2009, 13 20 ANALIZA KODUJĄCEJ SEKWENCJI NUKLEOTYDOWEJ GENU α A -GLOBINY GOŁĘBIA DOMOWEGO (COLUMBA LIVIA VAR. DOMESTICA) ORAZ SIERPÓWKI (STREPTOPELIA DECAOCTO) Henryk Dolecki,

Bardziej szczegółowo

Wyszukiwanie podobnych sekwencji w bazach danych. Wyszukiwanie w sekwencji nukleotydów czy aminokwasów? Czułość i selektywność

Wyszukiwanie podobnych sekwencji w bazach danych. Wyszukiwanie w sekwencji nukleotydów czy aminokwasów? Czułość i selektywność Wersja 1.05 Wprowadzenie do Informatyki Biomedycznej Wykład 3: Wyszukiwanie w bazach sekwencji Przewidywanie genów Wydział Informatyki PB Marek Krętowski pokój 206 e-mail: m.kretowski@pb.edu.pl http://aragorn.pb.bialystok.pl/~mkret

Bardziej szczegółowo

Infrastr ukt ura, procedur y i standardy digit aliz acji.

Infrastr ukt ura, procedur y i standardy digit aliz acji. Infrastr ukt ura, procedur y i standardy digit aliz acji. Marcin Kłos Centralne Muzeum Morskie m.klos@cmm.pl Konferencja DIGIMUZ Cyfrowe Muzea Pomorza 30.01.2009 r. Gdańsk. INFRASTRUKTURA PROCEDURY STANDARDY

Bardziej szczegółowo

Mutanty HBsAg Nowe wyzwanie w diagnostyce zakażenia wirusem zapalenia wątroby typu B

Mutanty HBsAg Nowe wyzwanie w diagnostyce zakażenia wirusem zapalenia wątroby typu B Mutanty HBsAg Nowe wyzwanie w diagnostyce zakażenia wirusem zapalenia wątroby typu B Mutanty HBsAg Białko powierzchniowe wirusa zapalenia wątroby typu B (HBsAg) jest najważniejszym markerem serologicznym

Bardziej szczegółowo

Oferta przetargu. Poland Tender. Nazwa. Miejscowość. Warszawa Numer ogłoszenia. Data zamieszczenia 2011-09-28. Typ ogłoszenia

Oferta przetargu. Poland Tender. Nazwa. Miejscowość. Warszawa Numer ogłoszenia. Data zamieszczenia 2011-09-28. Typ ogłoszenia Poland Tender Oferta przetargu Nazwa Dostawa oprogramowania komputerowego umożliwiającego tworzenie opracowań statystycznych obrazujących gospodarowanie Zasobem Własności Rolnej Skarbu Państwa Miejscowość

Bardziej szczegółowo

KONKURS MATEMATYCZNO PRZYRODNICZY

KONKURS MATEMATYCZNO PRZYRODNICZY KONKURS MATEMATYCZNO PRZYRODNICZY dla uczniów gimnazjów biorących udział w projekcie Mały Archimedes Instrukcja: 1. W konkursie niniejszym należy udzielić odpowiedzi na 26 zadań (20 zadań zamkniętych i

Bardziej szczegółowo

wykład dla studentów II roku biotechnologii Andrzej Wierzbicki

wykład dla studentów II roku biotechnologii Andrzej Wierzbicki Genetyka ogólna wykład dla studentów II roku biotechnologii Andrzej Wierzbicki Uniwersytet Warszawski Wydział Biologii andw@ibb.waw.pl http://arete.ibb.waw.pl/private/genetyka/ Wykład 5 Droga od genu do

Bardziej szczegółowo

Inwestycja w przyszłość czyli znaczenie ochrony własności przemysłowej dla współczesnej biotechnologii

Inwestycja w przyszłość czyli znaczenie ochrony własności przemysłowej dla współczesnej biotechnologii Inwestycja w przyszłość czyli znaczenie ochrony własności przemysłowej dla współczesnej biotechnologii Zdolność patentowa wynalazków biotechnologicznych aspekty praktyczne dr Małgorzata Kozłowska Ekspert

Bardziej szczegółowo

Oznaczanie aktywności proteolitycznej trypsyny Zajęcia 3-godzinne część A, zajęcia 4-godzinne część A i B

Oznaczanie aktywności proteolitycznej trypsyny Zajęcia 3-godzinne część A, zajęcia 4-godzinne część A i B znaczanie aktywności proteolitycznej trypsyny Zajęcia 3-godzinne część A, zajęcia 4-godzinne część A i B el ćwiczenia elem ćwiczenia jest zapoznanie się z metodą oznaczania aktywności endopeptydaz na przykładzie

Bardziej szczegółowo

Wyszukiwanie podstawowe - funkcja Basic Search

Wyszukiwanie podstawowe - funkcja Basic Search Przewodnik Baza Scopus jest wyposażona w narzędzia: Precyzyjnego zawężania zakresu poszukiwań Śledzenia cytowań pomocnych w ocenie dorobku naukowego (Research Performance Measurement - RPM) Niniejszy przewodnik

Bardziej szczegółowo

PL-Jastrzębie Zdrój: parts of conveyors 2010/S 94-142624 CONTRACT NOTICE - UTILITIES. Supplies

PL-Jastrzębie Zdrój: parts of conveyors 2010/S 94-142624 CONTRACT NOTICE - UTILITIES. Supplies CONTRACTING ENTITY PL-Jastrzębie Zdrój: parts of conveyors 2010/S 94-142624 CONTRACT NOTICE - UTILITIES Supplies NAME, ADDRESSES AND CONTACT POINT(S) Jastrzębska Spółka Węglowa Zakład Logistyki Materialowej

Bardziej szczegółowo

Entrez, wyszukiwarka dla nauk przyrodniczych: globalna kwerenda

Entrez, wyszukiwarka dla nauk przyrodniczych: globalna kwerenda Pomoc Entrez Entrez skupia literaturę naukową, bazy danych DNA i sekwencji białkowych, informacje o strukturach 3D oraz domenach białek, zbiory danych o badaniach na temat populacji, informacje o ekspresji,

Bardziej szczegółowo

Integracja APD z Ogólnopolskim Repozytorium Prac Dyplomowych i Otwartym Systemem Antyplagiatowym

Integracja APD z Ogólnopolskim Repozytorium Prac Dyplomowych i Otwartym Systemem Antyplagiatowym Integracja APD z Ogólnopolskim Repozytorium Prac Dyplomowych i Otwartym Systemem Antyplagiatowym... Łukasz Karniewski Uniwersytet Warszawski, MUCI l.karniewski@usos.edu.pl Warszawa, 2015-03-25 Plan prezentacji

Bardziej szczegółowo

Budowa wiadomości SMTP. autorzy: Aleksandra Wichert Marcin Żurowski

Budowa wiadomości SMTP. autorzy: Aleksandra Wichert Marcin Żurowski Budowa wiadomości SMTP autorzy: Aleksandra Wichert Marcin Żurowski Plan wykładu Co to jest SMTP? Koperta Nagłówek Wiadomość Co to jest SMTP? Prosty protokół przesyłania poczty elektronicznej (Simple Mail

Bardziej szczegółowo

Bia ka. Niezb dne. Aminokwasy. Tauryna. Kazeina NH 2 O H HO - S - C - CH2 O H NH2 PHE. Fenyloalanina VAL. Walina MET. Metionina.

Bia ka. Niezb dne. Aminokwasy. Tauryna. Kazeina NH 2 O H HO - S - C - CH2 O H NH2 PHE. Fenyloalanina VAL. Walina MET. Metionina. Bia ka TRY PHE VAL MET LEU LYS Tryptofan Fenyloalanina Walina Metionina Leucyna Lizyna ARG Arginina R CH NH 2 COOH THR Tryptofan Niezb dne aminokwasy N + OH O- C O- Aminokwasy Karnityna O H Tauryna Bia

Bardziej szczegółowo

Modelowanie hierarchicznych struktur w relacyjnych bazach danych

Modelowanie hierarchicznych struktur w relacyjnych bazach danych Modelowanie hierarchicznych struktur w relacyjnych bazach danych Wiktor Warmus (wiktorwarmus@gmail.com) Kamil Witecki (kamil@witecki.net.pl) 5 maja 2010 Motywacje Teoria relacyjnych baz danych Do czego

Bardziej szczegółowo

Punktacja czasopism naukowych How scientific journals are pointed

Punktacja czasopism naukowych How scientific journals are pointed Punktacja czasopism naukowych How scientific journals are pointed Donata Kurpas Uniwersytet Medyczny, Wrocław Państwowa Medyczna Wyższa Szkoła Zawodowa, Opole Polska Opole, 04 kwietnia 2014 Na podstawie

Bardziej szczegółowo

Drożdżowe systemy ekspresyjne

Drożdżowe systemy ekspresyjne Drożdże Drożdżowe systemy ekspresyjne Zalety: możliwość uzyskania dużej biomasy modyfikacje postranslacyjne eksprymowanych białek transport eksprymowanych białek do pożywki Duża biomasa W przypadku hodowli

Bardziej szczegółowo

OdświeŜanie hurtownie danych - wykład IV. Zagadnienia do omówienia. Wprowadzenie

OdświeŜanie hurtownie danych - wykład IV. Zagadnienia do omówienia. Wprowadzenie OdświeŜanie hurtownie danych - wykład IV Paweł Skrobanek, C-3 pok. 323 pawel.skrobanek@pwr.wroc.pl oprac. Wrocław 2006/2007 Zagadnienia do omówienia 1. Wprowadzenie 2. Klasyfikacja źródeł danych 3. Wymagania

Bardziej szczegółowo

Geny i działania na nich

Geny i działania na nich Metody bioinformatyki Geny i działania na nich prof. dr hab. Jan Mulawka Trzy królestwa w biologii Prokaryota organizmy, których komórki nie zawierają jądra, np. bakterie Eukaryota - organizmy, których

Bardziej szczegółowo

... Zadanie 7 (2 pkt.). Antykodon wskazuje strzałka oznaczona literą... Opisz funkcję pełnioną przez antykodon w trna.

... Zadanie 7 (2 pkt.). Antykodon wskazuje strzałka oznaczona literą... Opisz funkcję pełnioną przez antykodon w trna. Zadanie 1. (2 pkt.) W tabeli przedstawiono kodony kodu genetycznego. Poniżej przedstawiono dwie sekwencje nukleotydów w mrna. Ustal czy koduja takie same czy inne odcinki polipeptydów. Uzasadnij jednym

Bardziej szczegółowo

I 3 + d l a : B E, C H, C Y, C Z, ES, F R, G B, G R, I E, I T, L T, L U V, P T, S K, S I

I 3 + d l a : B E, C H, C Y, C Z, ES, F R, G B, G R, I E, I T, L T, L U V, P T, S K, S I M G 6 6 5 v 1. 2 0 1 5 G R I L L G A Z O W Y T R Ó J P A L N I K O W Y M G 6 6 5 I N S T R U K C J A U 7 Y T K O W A N I A I B E Z P I E C Z E Ń S T W A S z a n o w n i P a s t w o, D z i ę k u j e m y

Bardziej szczegółowo

Komputerowe wspomaganie projektowanie leków

Komputerowe wspomaganie projektowanie leków Komputerowe wspomaganie projektowanie leków wykład V Prof. dr hab. Sławomir Filipek Grupa BIOmodelowania Uniwersytet Warszawski, Wydział Chemii oraz Centrum Nauk Biologiczno-Chemicznych Cent-III www.biomodellab.eu

Bardziej szczegółowo

Wprowadzenie do psql i SQL. Język komend psql. Podstawy instrukcji SELECT

Wprowadzenie do psql i SQL. Język komend psql. Podstawy instrukcji SELECT Wprowadzenie do psql i SQL 1 Bazy Danych Wykład p.t. Wprowadzenie do psql i SQL. Język komend psql. Podstawy instrukcji SELECT Antoni Ligęza ligeza@agh.edu.pl http://galaxy.uci.agh.edu.pl/~ligeza Wykorzystano

Bardziej szczegółowo

SQL 4 Structured Query Lenguage

SQL 4 Structured Query Lenguage Wykład 5 SQL 4 Structured Query Lenguage Instrukcje sterowania danymi Bazy Danych - A. Dawid 2011 1 CREATE USER Tworzy nowego użytkownika Składnia CREATE USER specyfikacja użytkownika [, specyfikacja użytkownika]...

Bardziej szczegółowo

Struktura i funkcja białek (I mgr)

Struktura i funkcja białek (I mgr) Struktura i funkcja białek (I mgr) Dr Filip Jeleń fj@protein.pl http://www.protein.pl/ Jeremy M. Berg, John L. Tymoczko, Lubert Stryer Biochemia Carl Branden, John Tooze Introduction to Protein Structure

Bardziej szczegółowo

Politechnika Śląska. Wydział, Automatyki, Elektroniki i Informatyki

Politechnika Śląska. Wydział, Automatyki, Elektroniki i Informatyki Politechnika Śląska Wydział, Automatyki, Elektroniki i Informatyki Wybrane bazy danych adnotacji funkcjonalnych charakterystyka, opis, analiza jako struktury i powiązań. Analiza jakości oraz popularności

Bardziej szczegółowo

Wielojęzykowość w aplikacjach J2EE. Tomasz.Skutnik@e-point.pl

Wielojęzykowość w aplikacjach J2EE. Tomasz.Skutnik@e-point.pl e-point SA 7 marca, 2009 Co to jest duży system? Domeny narodowe Warianty językowe Funkcje (ekrany) Klucze lokalizacyjne Tabele językowe w bazie danych Gdzie mogą wystąpić problemy? Środowisko uruchomieniowe

Bardziej szczegółowo

Tłumaczenie tytułu kolumny w języku polskim

Tłumaczenie tytułu kolumny w języku polskim I Dane o projekcie kursu intensywnego, które należy zamieścić w raporcie z realizacji kursu intensywnego w roku akademickim 2012/13 - Arkusz IP 2012-13_General L.p. Tytuł kolumny 1 Project Numer projektu

Bardziej szczegółowo

z d n i a 2 3. 0 4.2 0 1 5 r.

z d n i a 2 3. 0 4.2 0 1 5 r. C h o r ą g i e w D o l n o l ą s k a Z H P I. P o s t a n o w i e n i a p o c z ą t k o w e U c h w a ł a n r 1 5 / I X / 2 0 1 5 K o m e n d y C h o r ą g w i D o l n o l ą s k i e j Z H P z d n i a

Bardziej szczegółowo

u l. W i d o k 8 t e l. 2 2 6 9 0 6 9 6 9

u l. W i d o k 8 t e l. 2 2 6 9 0 6 9 6 9 T A D E U S Z R O L K E J U T R O B Ę D Z I E L E P I E J T o m o r r o w W i l l B e B e t t e r K a w i a r n i a F a f i k, K r a k ó w, 1 9 9 2 F a f i k C a f e, C r a c o w, 1 9 9 2 W ł a c i c i

Bardziej szczegółowo

Umowa o współpracy ponadnarodowej

Umowa o współpracy ponadnarodowej Wzór minimalnego zakresu umowy o współpracy ponadnarodowej w ramach PO KL Umowa o współpracy ponadnarodowej Nazwa Programu Operacyjnego w Polsce: : Numer i nazwa Priorytetu: Numer i nazwa Działania: Numer

Bardziej szczegółowo

Struktura logiczna informacji o przychodach (dochodach) wypłaconych lub postawionych do dyspozycji faktycznemu albo po

Struktura logiczna informacji o przychodach (dochodach) wypłaconych lub postawionych do dyspozycji faktycznemu albo po Załącznik nr 29 Struktura logiczna informacji o przychodach (dochodach) wypłaconych lub postawionych do dyspozycji faktycznemu albo pośredniemu odbiorcy (IFT-3/IFT-3R) Nazwa pliku XSD: http://e-deklaracje.mf.gov.pl/repozytorium/deklaracje/pit/ift-3(4)_v1-0.xsd

Bardziej szczegółowo

Bioinformatyka wykład 3.I.2008

Bioinformatyka wykład 3.I.2008 Bioinformatyka wykład 3.I.2008 Białkowa bioinformatyka strukturalna c.d. krzysztof_pawlowski@sggw.pl 2008-01-03 1 Plan wykładu analiza i porównywanie struktur białek. doświadczalne metody badania struktur

Bardziej szczegółowo

1. Na podanej sekwencji przeprowadź proces replikacji, oraz do obu nici proces transkrypcji i translacji, podaj zapis antykodonów.

1. Na podanej sekwencji przeprowadź proces replikacji, oraz do obu nici proces transkrypcji i translacji, podaj zapis antykodonów. mrna 1. Na podanej sekwencji przeprowadź proces replikacji, oraz do obu nici proces transkrypcji i translacji, podaj zapis antykodonów. GGA CGC GCT replikacja CCT GCG CGA transkrypcja aminokwasy trna antykodony

Bardziej szczegółowo

SPECYFIKACJA ISTOTNYCH WARUNKÓW ZAMÓWIENIA (oznaczana dalej jako SIWZ)

SPECYFIKACJA ISTOTNYCH WARUNKÓW ZAMÓWIENIA (oznaczana dalej jako SIWZ) SPECYFIKACJA ISTOTNYCH WARUNKÓW ZAMÓWIENIA (oznaczana dalej jako ) dla postępowania o udzielenie zamówienia publicznego w trybie przetargu nieograniczonego Nazwa zamówienia: Dostawa paszy dla myszy i szczurów

Bardziej szczegółowo

Wykład 2. SQL 1 Structured Query Lenguage

Wykład 2. SQL 1 Structured Query Lenguage Wykład 2 SQL 1 Structured Query Lenguage SQL (Structured Query Language) Język zapytań do bazy danych. IBM lata osiemdziesiąte. Stosowany w systemach zarządzania bazami danych (DBMS); Oracle, Paradox,Access,

Bardziej szczegółowo

mezoterapia Anti-Aging NCTF, NCTF HA 30 lat doêwiadczeƒ w medycynie estetycznej

mezoterapia Anti-Aging NCTF, NCTF HA 30 lat doêwiadczeƒ w medycynie estetycznej mezoterapia Anti-Aging NCTF, NCTF HA 30 lat doêwiadczeƒ w medycynie estetycznej ISO 13485:2003 Mezoterapia to metoda wykorzystywana od lat w medycynie. Polega na wstrzykiwaniu ma ych dawek substancji leczniczej

Bardziej szczegółowo

PAKIETY Zysk natychmiastowy 144 zł 288 zł 432 zł 720 zł 1080 zł Dochód z obrotu ------------ 20,16 zł 30,24 zł 100,80 zł 151,20 zł Razem 144 zł 308,16 zł 462,24 zł 820,80 zł 1231,20 zł Kurier Na koszt

Bardziej szczegółowo

Modele. Najcz. Metoda unicode definiuje sposób wyświetlania obiektu w postaci tekstowej. BooleanField - pole logiczne, True/False

Modele. Najcz. Metoda unicode definiuje sposób wyświetlania obiektu w postaci tekstowej. BooleanField - pole logiczne, True/False Ściaga z Django Modele 1 from django.db import models from django.contrib.auth.models import User 4 class Story(models.Model): 5 title = models.charfield(max_length=100, null=false, blank=false) 6 description

Bardziej szczegółowo

Azotowe związki organiczne

Azotowe związki organiczne strona 1/1 Azotowe związki organiczne Krystyna Bogdanowicz-Szwed Procesy zachodzące w żywych organizmach są ściśle związane z chemią wielofunkcyjnych związków organicznych zawierających w swoich cząsteczkach

Bardziej szczegółowo

Chemia organiczna. Aminokwasy. Zakład Chemii Medycznej Pomorskiego Uniwersytetu Medycznego

Chemia organiczna. Aminokwasy. Zakład Chemii Medycznej Pomorskiego Uniwersytetu Medycznego Chemia organiczna Aminokwasy Zakład Chemii Medycznej Pomorskiego Uniwersytetu Medycznego 1 Aminokwasy aminokwasy zawierają przynajmniej jedną grupę aminową i jedną karboksylową wzajemne ułożenie grupy

Bardziej szczegółowo

Internetowe bazy danych

Internetowe bazy danych Wyższa Szkoła Technologii Teleinformatycznych w Świdnicy Internetowe bazy danych wykład 6 dr inż. Jacek Mazurkiewicz e-mail: Jacek.Mazurkiewicz@pwr.wroc.pl Kontrola dostępu

Bardziej szczegółowo

1. DNA - podstawowy nośnik informacji genetycznej

1. DNA - podstawowy nośnik informacji genetycznej Elementy genetyki 1. DNA - podstawowy nośnik informacji genetycznej 1.1. Informacja o budowie i funkcjonowaniu organizmu zapisana w DNA początki genetyki jako nauki doświadczenia na bakteriach wywołujących

Bardziej szczegółowo

9. Wymiarowanie. 9.1 Wstęp. 9.2 Opis funkcje wymiarowania. Auto CAD 14 9-1

9. Wymiarowanie. 9.1 Wstęp. 9.2 Opis funkcje wymiarowania. Auto CAD 14 9-1 Auto CAD 14 9-1 9. Wymiarowanie. 9.1 Wstęp Wymiarowanie elementów jest ważnym etapem tworzenia rysunku. Dzięki wymiarom wielkość elementów znajdujących się na rysunku zostaje jednoznacznie określona. 9.2

Bardziej szczegółowo

INSTRUKCJA KORZYSTANIA Z BAZ PROQUEST

INSTRUKCJA KORZYSTANIA Z BAZ PROQUEST INSTRUKCJA KORZYSTANIA Z BAZ PROQUEST 1. Wybór bazy Po zalogowaniu się do Proquest a pierwszym krokiem jest wybranie bazy lub grupy baz, które chcecie Pańswo przeszukiwać w zależności od Państwa potrzeb

Bardziej szczegółowo