Bioinformatyka. Formaty danych - GenBank

Wielkość: px
Rozpocząć pokaz od strony:

Download "Bioinformatyka. Formaty danych - GenBank"


1 Bioinformatyka Wykład 4. E. Banachowicz Zakład Biofizyki Molekularnej IF UAM Formaty danych - GenBank Poco wprowadza się dane do komputerów? 1. żeby je pobrać 2. żeby coś odkryć Jeśli baza danych nie pozwala na wyszukanie potrzebnej informacji, jest by bezużyteczna. (Nawet największa baza!) Wykład 4,

2 Formaty danych - GenBank 1. dane muszą mieć jednoznaczną strukturę i zdefiniowane powiązania 2. dane muszą być stabilne Model danych w NCBI oparty jest na sekwencji DNA (stabilność), i daje możliwość śledzenia informacji od literatury do sekwencji. Stabilność danych OMIM literatura PubMed Full Text el. Journal sekwencja DNA struktura 3D Mapy i genomy sekwencja białka Taksonomia 4 podstawowe dane Wykład 4,

3 pliki ASCII większość programów do analizy sekwencji nie akceptuje znaków spoza zestawu ASCII (różna interpretacja, problemy z transferem) Poza sekwencją DNA lub białka (raw sequence) odpowiedni format Kod DNA i białka ujednolicony został przez NC-IUB (Nomenclature Committee of the International Union of Biochemistry and Molecular Biology - Zasady/kwasy nukleinowe - ujednolicony kod NC IUP (1984) A adenozyna C cytozyna G guanina T tymidyna U urydyna R G A (puryna) Y T C (pyrymidyna) K G T (keto) M A C (amino) S G C (strong) W A T (weak) B G T C D G A T H A C T V G C A N A G C T (dowolna) - gap of indeterminate length Wykład 4,

4 Standardowy kod aminokwasów A Ala alanina P Pro prolina B Asx kw. asparaginowy/asparagina Q Gln glutamina C Cys cysteina R Arg arginina D Asp kw. asparaginowy S Ser seryna E Glu kw. glutaminowy T Thr treonina F Phe fenyloanina U selenocysteina G Gly glicyna V Val walina H His histydyna W Trp tryptofan I Ile izoleucyna Y Tyr tyrozyna K Lys lizyna Z Glx kw.glutaminowy/glutamina L Leu leucyna X Xxx dowolny M Met metionina * stop translacji N Asn asparagina - gap of indeterminate length Abstract Syntax Notation Sequence Format ASN.1 ASN.1 (skrót od Abstract Syntax Notation One abstrakcyjna notacja składniowa numer jeden) język opisu danych przejęty i rozwijany przez NCBI Wykład 4,

5 Integracja danych z wielu różnych źródeł np. PubMed (np. wyszukiwanie według autorów) MEDLINE Display Tag Name AB Abstract AD Affiliation AID Article Identifier AU Author CI Copyright Information CIN Comment In CN Corporate Author CON Comment On CRF Corrected and republished from CRI Corrected and republished in DA Date Created DCOM Date Completed DEP Date of Electronic Publication DP Publication Date EDAT Entrez Date EFR Erratum For EIN Erratum In FAU Full Author Name FIR Full Investigator FPS Full Personal Name as Subject GN General Note GR Grant Number GS Gene Symbol IP Issue IR Investigator IRAD Investigator Affiliation IS ISSN JID NLM Unique ID JT Full Journal Title LA Language LID Location ID LR MH MHDA OAB OCI OID ORI OT OTO OWN PG PHST PL PMID PRIN PROF PS PST PT PUBM RF RIN RN ROF RPF RPI SB SFM SI SO SPIN STAT TA TI TT UIN UOF VI Last Revision Date MeSH Terms MeSH Date Other Abstract Other Copyright Information Other ID Original Report In Other Term Other Term Owner Owner Pagination Publication History Status Date Place of Publication PubMed Unique Identifier Partial Retraction In Partial Retraction Of Personal Name as Subject Publication Status Publication Type Publishing Model Number of References Retraction In EC/RN Number Retraction Of Republished From Republished In Subset Space Flight Mission Secondary Source Identifier Source Summary For Patients In Status Tag Journal Title Abbreviation Title Transliterated Title Update In Update Of Volume Wykład 4,

6 cytowanie streszczenie brak streszczenia dostępny w PMC autorzy dostępny pełen teskt identyfikator czasopismo data publikacji nr stron tytuł Seq-id klasa obiektów DDBJ/GenBank/EMBL Podobna struktura i identyfikatory: A12345=A12345 PIR/ Swiss-Prot Różne identyfikatory: A12345 A12345 Wykład 4,

7 GenBank: nazwa lokusa (locus) długość i typ sekwencji klasyfikacja organizmu data wprowadzenia nazwa lokusa (locus) długość i typ sekwencji klasyfikacja organizmu data wprowadzenia Wykład 4,

8 GenBank: opis objektu ACCESSION numer dostępu do oryginalnego źródła VERSION numer kolejnej wersji KEYWORDS słowa kluczowe (cross reference) SOURCE organizm, z którego pochodziło DNA ORGANISM opis organizmu REFERENCE bibliografia GenBank: COMMENT np.funkcja biologiczna FEATURES informacje o sekwencji przez podanie położenia zasad lub przedziału położeń sourece, misc_signal, mrna, CDS, intron, mutation ORIGIN początek sekwencji // koniec sekwencji Wykład 4,

9 EMBL: European Molecular Biology Laboratory Wygląd strony w 2006 Wykład 4,

10 EMBL: European Molecular Biology Laboratory ID numer identyfikacyjny w bazie danych AC numer dostępowy do pierwotnej sekwencji SV wersja DT data wprowadzenia lub modyfikacji DE opis OS,OC organizm pochodzenia DNA RN (RP, RA, RT, RL, ) bibliografia FH, FT informacje o sekwencji (FEATUREs) SQ, // - początek i koniec sekwencji Wykład 4,

11 Format sekwencji FASTA >embl DQ DQ Influenza A virus (A/Cygnus olor/astrakhan/ast /2005(H5N1)) polymerase basic protein 1 (PB1) gene, complete cds.... caaaccatttgaatggatgtcaatccgactttacttttcttgaaagtaccagtgcaaaat gctataagtaccacattcccttatactggagaccctccatacagccatgggacagggaca ggatacaccatggacacagtcaacagaacacaccaatattcagaaaaggggaagtggaca acaaacacagagactggagcaccccaactcaacccgattgatggaccactacctgaggat aatgagcccagtggttatgcacaaacagattgtgtattggaagcaatggctttccttgaa gaatcccacccagggatctttgaaaactcgtgtcttgaaacgatggaaattgttcaacaa acaagagtggataaactgacccaaggtcgtcagacctatgactggacattgaatagaaac >gi gb ABD polymerase basic protein 1 [Influenza A virus (A/Cygnus olor/astrakhan/ast05-2- caaccggctgcaaccgctttggccaacactatagaaatcttcagatcgaacggtctaaca 10/2005(H5N1))] gccaatgaatcgggacggctaatagatttcctcaaggatgtgatggaatcaatggataag MDVNPTLLFLKVPVQNAISTTFPYTGDPPYSHGTGTGYTMDTVNRTHQYSEKGKWTTNTETGAPQLNPID gaagaaatggagataacaacacacttccagagaaagagaagagtgagagacaacatgacc GPLPEDNEPSGYAQTDCVLEAMAFLEESHPGIFENSCLETMEIVQQTRVDKLTQGRQTYDWTLNRNQPAA aaaaagatggtcacacaaagaacaatagggaagaaaaagcaaaggctgaacaaaaagagc TALANTIEIFRSNGLTANESGRLIDFLKDVMESMDKEEMEITTHFQRKRRVRDNMTKKMVTQRTIGKKKQ tacctgataagagcactgacactgaatacaatgacaaaagatgcagaaagaggcaaattg RLNKKSYLIRALTLNTMTKDAERGKLKRRAIATPGMQIRGFVYFVETLARSICEKLEQSGLPVGGNEKKA KLANVVRKMMTNSQDTELSFTITGDNTKWNENQNPRMFLAMITYITRNQPEWFRNVLSIAPIMFSNKMAR aagaggcgagcaattgcaacacccggaatgcaaatcagaggattcgtgtactttgttgaa LGRGYMFESKSMKLRTQIPAEMLANIDLKYFNELTKKKIEKIRPLLIDGTASLSPGMMMGMFNMLSTVLG acattagcgaggagtatctgtgagaaacttgagcaatctggactcccagttggagggaat VSILNLGQKRYTKTTYWWDGLQSSDDFALIVNAPNHEGIQAGVDRFYRTCKLVGINMSKKKSYINRTGTF gaaaagaaggctaaattggcaaacgtcgtgaggaagatgatgactaactcacaagatact EFTSFFYRYGFVANFSMELPSFGVSGINESADMSIGVTVIKNNMINNDLGPATAQMALQLFIKDYRYTYR gaactctcctttacaattactggagacaatactaaatggaatgagaatcagaatcctagg CHRGDTQIQTRRSFELKKLWEQTRSKAGLLVSDGGPNLYNIRNLHIPEVCLKWELMDEDYQGRLCNPLNP FVSHKEIESVNNAVVMPAHGPAKGMEYDAVATTHSWIPKRNRSILNTSQRGILEDEQMYQKCCNLFEKFF PSSSYRRPVGISSMVEAMVSRARIDARIDFESGRIKKEEFAEIMKICSTIEELRRPK > jednoliniowy opis wszystkie linie tekstu nie powinny być dłuższe niż 80 znaków Wykład 4,


13 znane formaty sekwencji ID Name Read Write Int'leaf Features Sequence Content-type Suffix 1 GenBank gb yes yes -- yes yes biosequence/ 2 EMBL em yes yes -- yes yes biosequence/embl.embl 3 Pearson Fasta fa yes yes yes biosequence/fasta.fasta 4 GCG yes yes yes biosequence/gcg.gcg 5 MSF yes yes yes -- yes biosequence/msf.msf 6 Clustal yes yes yes -- yes biosequence/clustal.aln 7 NBRF yes yes yes biosequence/nbrf.nbrf 8 PIR CODATA yes yes yes biosequence/codata.pir 9 ACEDB yes yes yes biosequence/acedb.ace 10 Phylip3.2 yes yes yes -- yes biosequence/phylip2.phylip2 11 Phylip Phylip4 yes yes yes -- yes biosequence/phylip.phylip 12 Plain Raw yes yes yes biosequence/plain.seq 13 PAUP NEXUS yes yes yes -- yes biosequence/ 14 XML yes yes -- yes yes biosequence/xml.xml 15 FlatFeat FFF yes yes -- yes -- biosequence/fff.fff 16 GFF yes yes -- yes -- biosequence/gff.gff 17 BLAST yes -- yes -- yes biosequence/blast.blast 18 Pretty -- yes yes -- yes biosequence/pretty.pretty 19 SCF yes yes biosequence/scf.scf 20 DNAStrider yes yes yes biosequence/strider.strider 21 IG Stanford yes yes yes biosequence/ig.ig 22 Fitch yes biosequence/fitch.fitch 23 ASN yes biosequence/asn1.asn Anatomia danych SwissProt/TrEMBL Wykład 4,

14 Wykład 4,

15 MeCP2 NCBI b=protein&val= EMBL-EBI PIR ReadSeq PDB Wykład 4,

16 plik PDB plik PDB Wykład 4,

17 plik PDB plik PDB Ser Lys Val Wykład 4,

18 plik PDB Identyfikacja sekwencji w BD Identyfikacja przez porównanie z innymi sekwencjami Zestawienia sekwencji = uliniowienie = =porównanie = alignment Wykład 4,

19 Porównywanie sekwencji Pierwsze pytanie biologa molekularnego, kiedy odkryje nową sekwencję: Czy w bazie sekwencji są już sekwencje podobne do mojej? sekwencje są identyczne nic nowego. sekwencja jest podobna (ma krewnych ) nowy członek znanej rodziny sekwencja ma kilka podobnych regionów, motywów lub domen można zaproponować funkję Nie ma znaczącego podobieństwa dużo pracy.. Porównywanie sekwencji Celem porównania białek jest między innymi przypisanie informacji znanej dla jednej cząsteczki drugiej cząsteczce Wykład 4,

20 Pokrycie sekwencji dopasowanie globalne dopasowanie wzdłuż całej sekwencji (zastosowanie: do białek składających się z pojedynczej domeny lub homologicznych słabo zróżnicowanych) dopasowanie lokalne uwzględnia domenową naturę białek, szuka subsekwencji (zastosowanie: do białek wielodomenowych, mrna z sekwencją genomową) 39 BLAST Wykład 4,

21 Wykład 4,

22 ćwiczeniach Wykład 4,

Bioinformatyka. Michał Bereta

Bioinformatyka. Michał Bereta Bioinformatyka Michał Bereta 1 Bazy danych biologicznych Bazy danych sekwencji nukleotydowych Pierwotne bazy danych (ang. primary database) Wykorzystywane do zbierania

Bardziej szczegółowo

21. Wstęp do chemii a-aminokwasów

21. Wstęp do chemii a-aminokwasów 21. Wstęp do chemii a-aminokwasów Chemia rganiczna, dr hab. inż. Mariola Koszytkowska-Stawińska, WChem PW; 2016/2017 1 21.1. Budowa ogólna a-aminokwasów i klasyfikacja peptydów H 2 N H kwas 2-aminooctowy

Bardziej szczegółowo

IZOMERIA Izomery - związki o takim samym składzie lecz różniące się budową

IZOMERIA Izomery - związki o takim samym składzie lecz różniące się budową IZMERIA Izomery - związki o takim samym składzie lecz różniące się budową TAK zy atomy są tak samo połączone? NIE izomery konstytucyjne stereoizomery zy odbicie lustrzane daje się nałożyć na cząsteczkę?

Bardziej szczegółowo

Budowa aminokwasów i białek

Budowa aminokwasów i białek Biofizyka Ćwiczenia 1. E. Banachowicz Zakład Biofizyki Molekularnej IF UAM Budowa aminokwasów i białek E.Banachowicz 1 Ogólna budowa aminokwasów α w neutralnym p α N 2 COO N

Bardziej szczegółowo

Bioinformatyka. z sylabusu...

Bioinformatyka. z sylabusu... Bioinformatyka Wykład 1. E. Banachowicz Zakład Biofizyki Molekularnej IF UAM z sylabusu... Wykład 1, 2008 1 Co to jest Bioinformatyka? Zastosowanie technologii informacji do

Bardziej szczegółowo

Bioinformatyka. z sylabusu... (wykład monograficzny) wykład 1. E. Banachowicz. Wykład monograficzny Bioinformatyka.

Bioinformatyka. z sylabusu... (wykład monograficzny) wykład 1. E. Banachowicz. Wykład monograficzny Bioinformatyka. Bioinformatyka (wykład monograficzny) wykład 1. E. Banachowicz Zakład Biofizyki Molekularnej IF UAM z sylabusu... Wykład 1, 2006 1 Co to jest Bioinformatyka? Zastosowanie technologii

Bardziej szczegółowo

Podstawy bioinformatyki - biologiczne bazy danych

Podstawy bioinformatyki - biologiczne bazy danych Podstawy bioinformatyki - biologiczne bazy danych Czym jest bioinformatyka? Bioinformatyka Bioinformatyka jest interdyscyplinarną dziedziną nauki obejmującą wykorzystanie metod obliczeniowych do badania

Bardziej szczegółowo

Bioinformatyka Laboratorium, 30h. Michał Bereta

Bioinformatyka Laboratorium, 30h. Michał Bereta Laboratorium, 30h Michał Bereta Zasady zaliczenia przedmiotu Kolokwia (3 4 ) Ocena aktywności i przygotowania Obecnośd Literatura, materiały Bioinformatyka i ewolucja

Bardziej szczegółowo


BIOINFORMATYKA BIOLOGICZNE BAZY DANYCH Podstawy Bioinformatyki II BIOINFORMATYKA BIOLOGICZNE BAZY DANYCH 1 Czym jest bioinformatyka? 2 Bioinformatyka Bioinformatyka jest interdyscyplinarną dziedziną nauki obejmującą wykorzystanie

Bardziej szczegółowo

EWOLUCJA GENOMÓW. Bioinformatyka, wykład 6 (22.XI.2010)

EWOLUCJA GENOMÓW. Bioinformatyka, wykład 6 (22.XI.2010) EWOLUCJA GENOMÓW Bioinformatyka, wykład 6 (22.XI.2010) Wykład 6 spis treści genomika mapowanie genomów początki ewolucji świat RNA świat wirusów (?) ewolucja genomów GENOMIKA

Bardziej szczegółowo

Bioinformatyka. Bazy danych. Wykład 3. E. Banachowicz. Wykład monograficzny Bioinformatyka. Wykład 3, Zakład Biofizyki Molekularnej IF UAM

Bioinformatyka. Bazy danych. Wykład 3. E. Banachowicz. Wykład monograficzny Bioinformatyka. Wykład 3, Zakład Biofizyki Molekularnej IF UAM Bioinformatyka Wykład 3. E. Banachowicz Zakład Biofizyki Molekularnej IF UAM Bazy danych Wykład 3, 2008 1 Niesekwencyjne BazyDanych bibliograficzne kliniczne ścieżek metabolicznych

Bardziej szczegółowo

aminokwasy O H H 2 O C H R biogeniczne: α, należą do szeregu L

aminokwasy O H H 2 O C H R biogeniczne: α, należą do szeregu L aminokwasy 2 biogeniczne: α, należą do szeregu L podział aminokwasów ze względu na typ grupy bocznej: - obecność grupy kwasowej lub zasadowej w grupie bocznej - jonowość (polarność) grupy bocznej 2 2-3

Bardziej szczegółowo

Związki biologicznie aktywne

Związki biologicznie aktywne Związki biologicznie aktywne Tematyka wykładów 1. Chemia związków biologicznie aktywnych pojęcia ogólne, klasyfikacja leków. 2. Związki biologicznie aktywne jako związki pochodzenia naturalnego, półsyntetycznego

Bardziej szczegółowo

protos (gr.) pierwszy protein/proteins (ang.)

protos (gr.) pierwszy protein/proteins (ang.) Białka 1 protos (gr.) pierwszy protein/proteins (ang.) cząsteczki życia materiał budulcowy materii ożywionej oraz wirusów wielkocząsteczkowe biopolimery o masie od kilku tysięcy do kilku milionów jednostek

Bardziej szczegółowo

Sekcja I: Instytucja zamawiająca/podmiot zamawiający

Sekcja I: Instytucja zamawiająca/podmiot zamawiający Unia Europejska Publikacja Suplementu do Dziennika Urzędowego Unii Europejskiej 2, rue Mercier, 2985 Luxembourg, Luksemburg Faks: +352 29 29 42 670 E-mail: Informacje i formularze

Bardziej szczegółowo

Bioinformatyczne bazy danych - część 2. -przeszukiwanie baz danych -pobieranie danych

Bioinformatyczne bazy danych - część 2. -przeszukiwanie baz danych -pobieranie danych Bioinformatyczne bazy danych - część 2 -przeszukiwanie baz danych -pobieranie danych Numery dostępowe baz danych (accession number) to ciąg liter i cyfr służących jako etykieta identyfikująca sekwencję

Bardziej szczegółowo

Budowa i funkcje białek

Budowa i funkcje białek Budowa i funkcje białek Białka Wszystkie organizmy zawierają białko Każdy organizm wytwarza własne białka Podstawowe składniki białek - aminokwasy Roślinne mogą wytwarzać aminokwasy ze związków nieorganicznych

Bardziej szczegółowo

SciFinder Podstawy wyszukiwania

SciFinder Podstawy wyszukiwania SciFinder Podstawy wyszukiwania Jeżeli szukasz... literatury na zadany temat publikacji określonego autora prac pracowników danej firmy lub instytucji artykułów z wybranego tytułu czasopisma patentu o

Bardziej szczegółowo

Ogólna budowa aminokwasów

Ogólna budowa aminokwasów H w neutralnym ph H NH 3 + C COO - NH 2 C COOH R R grupa aminowa - NH 2 grupa karboksylowa - COOH Gly, G Ala, A Ogólna budowa aminokwasów Reguła CORN H R NH 3 + C L lewoskrętny (COO-R-N) COO - 1 20 aminokwasów

Bardziej szczegółowo

Ćwiczenie nr 7. Aminokwasy i peptydy. Repetytorium. Repetytorium

Ćwiczenie nr 7. Aminokwasy i peptydy. Repetytorium. Repetytorium Repetytorium Ćwiczenie nr 7 dr Mariola Krawiecka Aminokwasy i peptydy 1. Podział aminokwasów. 2. Właściwości aminokwasów-aminokwasy jako jony obojnacze. 3. Reaktywność aminokwasów. 4. Biologicznie ważne

Bardziej szczegółowo

Skrypt Bioinformatyka DRAFT Strona 25

Skrypt Bioinformatyka DRAFT Strona 25 Spis treści 4 Budowa aminokwasów i białek... 26 4.1 Ogólna budowa aminokwasów... 26 4.2 Kalkulator własności fizykochemicznych białka... 40 4.3 Metody analizy własności aminokwasów... 44 4.3.1 Metoda Analizy

Bardziej szczegółowo

ETYKIETA. Fitmax Easy GainMass proszek

ETYKIETA. Fitmax Easy GainMass proszek ETYKIETA Fitmax Easy GainMass proszek smak waniliowy, truskawkowy, czekoladowy Środek spożywczy zaspokajający zapotrzebowanie organizmu przy intensywnym wysiłku fizycznym, zwłaszcza sportowców. FitMax

Bardziej szczegółowo

Bioinformatyka. (wykład monograficzny) wykład 5. E. Banachowicz. Zakład Biofizyki Molekularnej IF UAM

Bioinformatyka. (wykład monograficzny) wykład 5. E. Banachowicz. Zakład Biofizyki Molekularnej IF UAM Bioinformatyka (wykład monograficzny) wykład 5. E. Banachowicz Zakład Biofizyki Molekularnej IF UM lgorytmy macierze punktowe (DotPlot) programowanie dynamiczne metody heurystyczne

Bardziej szczegółowo

Spis treści. Przedmowa... XI. Wprowadzenie i biologiczne bazy danych. 1 Wprowadzenie... 3. 2 Wprowadzenie do biologicznych baz danych...

Spis treści. Przedmowa... XI. Wprowadzenie i biologiczne bazy danych. 1 Wprowadzenie... 3. 2 Wprowadzenie do biologicznych baz danych... Przedmowa... XI Część pierwsza Wprowadzenie i biologiczne bazy danych 1 Wprowadzenie... 3 Czym jest bioinformatyka?... 5 Cele... 5 Zakres zainteresowań... 6 Zastosowania... 7 Ograniczenia... 8 Przyszłe

Bardziej szczegółowo

1 porcji (30 % RDA 100 g odżywcza* Wartość energetyczna kj / 384 kcal

1 porcji (30 % RDA 100 g odżywcza* Wartość energetyczna kj / 384 kcal Smak waniliowy 1605 kj / 384 kcal 481,5 kj / 115 kcal Białko 74,4g 22,5g Węglowodany 8,2 g 2,45 g Tłuszcz 6,0 g 1,8 g Bilans aminokwasowy na : Asparagina 9952 mg 2985mg Fenyloalanina* 2724 mg 817mg Leucyna*

Bardziej szczegółowo

Budowa aminokwasów i białek

Budowa aminokwasów i białek Bioinformatyka Wykład 2. E. Banachowicz Zakład Biofizyki Molekularnej IF UAM Budowa aminokwasów i białek Bioinformatyka 2, 2011 1 Ogólna budowa aminokwasów H w neutralnym ph

Bardziej szczegółowo

wykład dla studentów II roku biotechnologii Andrzej Wierzbicki

wykład dla studentów II roku biotechnologii Andrzej Wierzbicki Genetyka ogólna wykład dla studentów II roku biotechnologii Andrzej Wierzbicki Uniwersytet Warszawski Wydział Biologii Wykład 4 Jak działają geny?

Bardziej szczegółowo

Właściwości aminokwasów i białek

Właściwości aminokwasów i białek Właściwości aminokwasów i białek el ćwiczenia Ćwiczenie ma na celu poznanie niektórych typowych reakcji aminokwasów i białek. Reakcje te pozwalają odróżnić wolne aminokwasy od białek i innych związków

Bardziej szczegółowo

WHEY CORE BCAA Amino Mega Strong - 2,3kg + 500ml

WHEY CORE BCAA Amino Mega Strong - 2,3kg + 500ml Utworzono: 2017-01-20 19:50:01 WHEY CORE 100 + BCAA Amino Mega Strong - 2,3kg + 500ml Cena produktu: 198,90 PLN 157,00 PLN Wyjątkowy w smaku koktajl proteinowy ze 100% białkiem serwatkowym (WPC, WPI) o

Bardziej szczegółowo

Wykład 10 2008-04-30. Bioinformatyka. Wykład 9. E. Banachowicz. Zakład Biofizyki Molekularnej IF UAM

Wykład 10 2008-04-30. Bioinformatyka. Wykład 9. E. Banachowicz. Zakład Biofizyki Molekularnej IF UAM Bioinformatyka Wykład 9 E. Banachowicz Zakład Biofizyki Molekularnej IF UAM 1 Konsekwencje zestawieo wielu sekwencji - rodziny białkowe, domeny, motywy i wzorce 2 Bioinformatyka,

Bardziej szczegółowo

Podstawy biologiczne - komórki. Podstawy biologiczne - cząsteczki. Model komórki eukariotycznej. Wprowadzenie do Informatyki Biomedycznej

Podstawy biologiczne - komórki. Podstawy biologiczne - cząsteczki. Model komórki eukariotycznej. Wprowadzenie do Informatyki Biomedycznej Wprowadzenie do Informatyki Biomedycznej Wykład 1: Podstawy bioinformatyki Wydział Informatyki PB Podstawy biologiczne - komórki Wszystkie organizmy zbudowane są z komórek komórka jest skomplikowanym systemem

Bardziej szczegółowo

Generator testów 1.3.1 Bioinformatyka_zdalne wer. 1.0.13 / 0 Strona: 1

Generator testów 1.3.1 Bioinformatyka_zdalne wer. 1.0.13 / 0 Strona: 1 Przedmiot: Bioinformatyka Nazwa testu: Bioinformatyka_zdalne wer. 1.0.13 Nr testu 0 Klasa: WNB UZ Odpowiedzi zaznaczamy TYLKO w tabeli! 1. Model Markowa substytucji aminokwasów w mutagenezie białek zakłada...

Bardziej szczegółowo

10/9/2013. Bioinformatyka i Biologia Obliczeniowa. BIOINFORMATYKA Co to jest i po co? Czym będziemy zajmować się na kursie: Tematyka wykładu

10/9/2013. Bioinformatyka i Biologia Obliczeniowa. BIOINFORMATYKA Co to jest i po co? Czym będziemy zajmować się na kursie: Tematyka wykładu Bioinformatyka i Biologia Obliczeniowa Mał Instytut InŜynierii Biomedycznej i Pomiarowej D1 pok. 115 Konsultacje: czwartek: godz. 9-11 wtorek 9-11 (preferowane info emailowe

Bardziej szczegółowo

FILOGENETYKA. Bioinformatyka, wykład. 8 c.d. 0)

FILOGENETYKA. Bioinformatyka, wykład. 8 c.d. 0) FILOGENETYKA Bioinformatyka, wykład 8 c.d. (7.XII.2010) 0) Filogenetyka Cel rekonstrukcja historii ewolucji wszystkich organizmów. Klasyczne podejście: historia ewolucji jest

Bardziej szczegółowo


INSTRUKCJA TECHNICZNA - Komputerowy Program żywieniowy WPROWADZANIE DANYCH O PACJENCIE. okno: NUTRITION/WYWIADY INSTRUKCJA TECHNICZNA - Komputerowy Program żywieniowy W celu rozpoczęcia pracy z programem należy się zalogować standardowe hasło programu to admin możliwość wprowadzenia własnego hasła poprzez

Bardziej szczegółowo

Przyrównanie sekwencji. Magda Mielczarek Katedra Genetyki Uniwersytet Przyrodniczy we Wrocławiu

Przyrównanie sekwencji. Magda Mielczarek Katedra Genetyki Uniwersytet Przyrodniczy we Wrocławiu Przyrównanie sekwencji Magda Mielczarek Katedra Genetyki Uniwersytet Przyrodniczy we Wrocławiu Sequence alignment - przyrównanie sekwencji Poszukiwanie ciągów znaków (zasad nukleotydowych lub reszt aminokwasowych),

Bardziej szczegółowo



Bardziej szczegółowo

Bioinformatyka. Wykład 2 (12.X.2010) I r. studiów magisterskich, biologia (SGGW) Krzysztof Pawłowski

Bioinformatyka. Wykład 2 (12.X.2010) I r. studiów magisterskich, biologia (SGGW) Krzysztof Pawłowski Bioinformatyka Wykład 2 (12.X.2010) I r. studiów magisterskich, biologia (SGGW) Krzysztof Pawłowski tydzień temu Co to jest bioinformatyka Sekwencjonowanie genomów historia Metagenomika Wykład 2 spis treści

Bardziej szczegółowo


BIOLOGICZNE BAZY DANYCH SYLABUS BIOLOGICZNE BAZY DANYCH SYLABUS Elementy składowe sylabusu Nazwa jednostki prowadzącej kierunek Nazwa kierunku studiów Poziom kształcenia Profil studiów Forma studiów Kod Język Rodzaj Rok studiów /semestr

Bardziej szczegółowo

Księgarnia PWN: A.D. Baxevanis, B.F.F. Ouellette Bioinformatyka

Księgarnia PWN: A.D. Baxevanis, B.F.F. Ouellette Bioinformatyka Księgarnia PWN: A.D. Baxevanis, B.F.F. Ouellette Bioinformatyka Słowo wstępne XIII Przedmowa XV 1. Bioinformatyka i Internet Andreas D. Baxevanis 1 1.1. Podstawy Internetu 2 1.2. Połączenie z Internetem

Bardziej szczegółowo

Najsmaczniejsze białko na rynku Bardzo dobry profil aminokwasowy Doskonała rozpuszczalność i jakość Zawiera nienaruszone frakcje białkowe.

Najsmaczniejsze białko na rynku Bardzo dobry profil aminokwasowy Doskonała rozpuszczalność i jakość Zawiera nienaruszone frakcje białkowe. Białka > Model : - Producent : Scitec 100% Whey Protein - doskonałe białko firmy Scitec Nutrition jest ultrafiltrowanym koncentratem białkowym o wysokiej jakości. Dzięki doskonałemu profilowi aminokwasowemu

Bardziej szczegółowo

Generator testów Bioinformatyka wer / 0 Strona: 1

Generator testów Bioinformatyka wer / 0 Strona: 1 Przedmiot: Nazwa przedmiotu Nazwa testu: Bioinformatyka wer. 1.0.6 Nr testu 0 Klasa: V zaoczne WNB UZ Odpowiedzi zaznaczamy TYLKO w tabeli! 1. Analiza porównawcza białek zwykle zaczyna się na badaniach

Bardziej szczegółowo

Przewodnik Użytkownika systemu POL-index. Opis formatu POL-index

Przewodnik Użytkownika systemu POL-index. Opis formatu POL-index Przewodnik Użytkownika systemu POL-index Opis formatu POL-index Opis formatu POL-index UWAGA: ze względu na krótki termin, jaki upłynął od komunikatu Ministra Nauki i Szkolnictwa Wyższego uruchamiający

Bardziej szczegółowo

etyloamina Aminy mają właściwości zasadowe i w roztworach kwaśnych tworzą jon alkinowy

etyloamina Aminy mają właściwości zasadowe i w roztworach kwaśnych tworzą jon alkinowy Temat: Białka Aminy Pochodne węglowodorów zawierające grupę NH 2 Wzór ogólny amin: R NH 2 Przykład: CH 3 -CH 2 -NH 2 etyloamina Aminy mają właściwości zasadowe i w roztworach kwaśnych tworzą jon alkinowy

Bardziej szczegółowo


1.1. AMINOKWASY BIAŁKOWE 1 ĆWICZENIE 1 BUDOWA I WŁAŚCIWOŚCI AMINOKWASÓW 1.1. AMINOKWASY BIAŁKOWE Aminokwasy są związkami organicznymi zawierającymi co najmniej jedną grupę karboksylową -COOH oraz co najmniej jedną grupę aminową

Bardziej szczegółowo

Bioinformatyka. z sylabusu...

Bioinformatyka. z sylabusu... Bioinformatyka Wykład 1. E. Banachowicz Zakład Biofizyki Molekularnej IF UAM z sylabusu... Wykład 1, 2010/2011 1 Orientacyjny plan wykładów 1. Przegląd baz danych, formaty danych

Bardziej szczegółowo


PODSTAWY BIOINFORMATYKI PODSTAWY BIOINFORMATYKI Prowadzący: JOANNA SZYDA ADRIAN DROśDś WSTĘP 1. Katedra Genetyki badania bioinformatyczne 2. Tematyka przedmiotu 3. Charakterystyka wykładów 4. Charakterystyka ćwiczeń 5. Informacje

Bardziej szczegółowo

Model : - SCITEC 100% Whey Protein Professional 920g

Model : - SCITEC 100% Whey Protein Professional 920g Białka > Model : - Producent : Scitec 100% Whey Protein Professional - jest najwyższej jakości, wolnym od laktozy, czystym koncentratem i izolat białek serwatkowych (WPC + WPI) o bardzo dobrej rozpuszczalności

Bardziej szczegółowo

Jest to dziedzina biologiczna wywodząca się z biotechnologii. Bioinformatyka

Jest to dziedzina biologiczna wywodząca się z biotechnologii. Bioinformatyka Wstęp do obsługi biologicznych baz danych i analizy porównawczej białek i genów Katedra Fizjologii i Biotechnologii Roślin Pok. 113 CB

Bardziej szczegółowo

Kwasy nukleinowe i białka

Kwasy nukleinowe i białka Metody bioinformatyki Kwasy nukleinowe i białka prof. dr hab. Jan Mulawka Kwasy nukleinowe DNA Kwas dezoksyrybonukleinowy jest to należący do kwasów nukleinowych wielkocząsteczkowy organiczny związek chemiczny,

Bardziej szczegółowo


BUDOWA I WŁAŚCIWOŚCI AMINOKWASÓW. 1.1. Aminokwasy białkowe BUDOWA I WŁAŚCIWOŚCI AMINOKWASÓW 1.1. Aminokwasy białkowe Aminokwasy są związkami organicznymi, zawierającymi co najmniej jedną grupę karboksylową COOH oraz co najmniej jedną grupę aminową NH 2. W zależności

Bardziej szczegółowo

Analiza danych pochodzących z sekwencjonowania nowej generacji - przyrównanie do genomu referencyjnego. - część I -

Analiza danych pochodzących z sekwencjonowania nowej generacji - przyrównanie do genomu referencyjnego. - część I - pochodzących z sekwencjonowania nowej generacji - przyrównanie do genomu referencyjnego - część I - Katedra Genetyki Uniwersytet Przyrodniczy we Wrocławiu Plan wykładów --------------------------------------------------------

Bardziej szczegółowo

Filogenetyka. Dr inż. Magdalena Święcicka, dr hab. Marcin Filipecki. Katedra Genetyki, Hodowli i Biotechnologii Roślin, SGGW

Filogenetyka. Dr inż. Magdalena Święcicka, dr hab. Marcin Filipecki. Katedra Genetyki, Hodowli i Biotechnologii Roślin, SGGW Filogenetyka Dr inż. Magdalena Święcicka, dr hab. Marcin Filipecki Katedra Genetyki, Hodowli i Biotechnologii Roślin, SGGW Filogenetyka Cel rekonstrukcja historii ewolucji wszystkich organizmów Klasyczne

Bardziej szczegółowo



Bardziej szczegółowo

Statystyczna analiza danych

Statystyczna analiza danych Statystyczna analiza danych ukryte modele Markowa, zastosowania Anna Gambin Instytut Informatyki Uniwersytet Warszawski plan na dziś Ukryte modele Markowa w praktyce modelowania rodzin białek multiuliniowienia

Bardziej szczegółowo


BUDOWA I FUNKCJA GENOMU LUDZKIEGO BUDOWA I FUNKCJA GENOMU LUDZKIEGO Magdalena Mayer Katedra i Zakład Genetyki Medycznej UM w Poznaniu 1. Projekt poznania genomu człowieka: Cele programu: - skonstruowanie szczegółowych map fizycznych i

Bardziej szczegółowo

Slajd 1. Slajd 2. Proteiny. Peptydy i białka są polimerami aminokwasów połączonych wiązaniem amidowym (peptydowym) Kwas α-aminokarboksylowy aminokwas

Slajd 1. Slajd 2. Proteiny. Peptydy i białka są polimerami aminokwasów połączonych wiązaniem amidowym (peptydowym) Kwas α-aminokarboksylowy aminokwas Slajd 1 Proteiny Slajd 2 Peptydy i białka są polimerami aminokwasów połączonych wiązaniem amidowym (peptydowym) wiązanie amidowe Kwas α-aminokarboksylowy aminokwas Slajd 3 Aminokwasy z alifatycznym łańcuchem

Bardziej szczegółowo

Motywy i podobieństwo

Motywy i podobieństwo Motywy i podobieństwo Całość funkcja Modularna budowa białek Elementy składowe czyli miejsca wiązania, domeny 1 Motywy Motyw jest opisem określonej części trójwymiarowej struktury zawierającym charakterystyczny

Bardziej szczegółowo

Aminokwasy, peptydy, białka


Bardziej szczegółowo


ĆWICZENIE 1 BUDOWA I WŁAŚCIWOŚCI AMINOKWASÓW ĆWICZENIE 1 BUDWA I WŁAŚCIWŚCI AMINKWASÓW 1.1. CEL ĆWICZENIA Zapoznanie się z budową i właściwościami aminokwasów i białek. Identyfikacja aminokwasów za pomocą reakcji charakterystycznych. 1.2. AMINKWASY

Bardziej szczegółowo


AMINOKWASY. BUDOWA I WŁAŚCIWOŚCI Ćwiczenie 1 AMINOKWASY. BUDOWA I WŁAŚCIWOŚCI Część doświadczalna obejmuje: - rozdział aminokwasów metodą chromatografii podziałowej (technika chromatografii bibułowej wstępującej) - miareczkowanie alaniny

Bardziej szczegółowo

Ćwiczenie 1. Właściwości aminokwasów i białek

Ćwiczenie 1. Właściwości aminokwasów i białek Ćwiczenie 1. Właściwości aminokwasów i białek el ćwiczenia elem ćwiczenia jest poznanie niektórych reakcji charakterystycznych stosowanych przy wykrywaniu aminokwasów i białek. eakcje te umoŝliwiają odróŝnienie

Bardziej szczegółowo


MAZURENKO ARMWRESTLING PROMOTION Sp. z o.o. Gdynia ETYKIETA. FITMAX MASS ACTIVE 20 proszek ETYKIETA FITMAX MASS ACTIVE 20 proszek Środek spożywczy zaspokajający zapotrzebowanie organizmu przy intensywnym wysiłku fizycznym, w szczególności sportowców. FitMax Mass Active 20 jest odżywką wspomagającą

Bardziej szczegółowo


AMINOKWASY. BUDOWA I WŁAŚCIWOŚCI Ćwiczenie 1 AMINOKWASY. BUDOWA I WŁAŚCIWOŚCI Część doświadczalna obejmuje: rozdział aminokwasów metodą chromatografii podziałowej (technika chromatografii bibułowej wstępującej) wykonanie reakcji charakterystycznych

Bardziej szczegółowo

Whey C6-1000g (Whey C-6) + Creatine Powder - 250g + Tribulus Terrestris Professional kaps.

Whey C6-1000g (Whey C-6) + Creatine Powder - 250g + Tribulus Terrestris Professional kaps. Utworzono: 2017-02-02 01:56:17 Whey C6-1000g (Whey C-6) + Creatine Powder - 250g + Tribulus Terrestris Professional - 100 kaps. Cena produktu: 107,50 PLN 99,00 PLN Whey C-6 to megaanaboliczny, wysokobiałkowy

Bardziej szczegółowo

Zastosowanie metody Lowry ego do oznaczenia białka w cukrze białym

Zastosowanie metody Lowry ego do oznaczenia białka w cukrze białym Zastosowanie metody Lowry ego do oznaczenia białka w cukrze białym Dr inż. Bożena Wnuk Mgr inż. Anna Wysocka Seminarium Aktualne zagadnienia dotyczące jakości w przemyśle cukrowniczym Łódź 10 11 czerwca

Bardziej szczegółowo

Pasze Totally Pathogen Free

Pasze Totally Pathogen Free Pasze Totally Pathogen Free gotowe do użycia za barierą higieniczną bez konieczności autoklawowania tańsze o 30% od pasz sterylizowanych promieniowaniem Gamma Altromin - produkcja pasz tylko dla zwierząt

Bardziej szczegółowo

Metabolizm białek. Ogólny schemat metabolizmu bialek

Metabolizm białek. Ogólny schemat metabolizmu bialek Metabolizm białek Ogólny schemat metabolizmu bialek Trawienie białek i absorpcja aminokwasów w przewodzie pokarmowym w żołądku (niskie ph ~2, rola HCl)- hydratacja, homogenizacja, denaturacja białek i

Bardziej szczegółowo

Czy białka zbudowane są z 20 rodzajów aminokwasów? jak radzi sobie z tym problemem modelowanie molekularne.

Czy białka zbudowane są z 20 rodzajów aminokwasów? jak radzi sobie z tym problemem modelowanie molekularne. Czy białka zbudowane są z 20 rodzajów aminokwasów? jak radzi sobie z tym problemem modelowanie molekularne. mgr Adrian Jasiński Zespół Teoretycznej Biofizyki Molekularnej Plan prezentacji Wstęp Niestandardowe

Bardziej szczegółowo

Rewolucja kolagenowa

Rewolucja kolagenowa Rewolucja kolagenowa Kolagen Najważniejsze białko ludzkiego organizmu Podstawowy budulec: skóry, paznokci, włosów, ścięgien, kości, stawów, chrząstek, rogówki oka, naczyń krwionośnych i limfatycznych Fundament

Bardziej szczegółowo

Metadane w Jagiellońskiej Bibliotece Cyfrowej. Piotr Myszkowski

Metadane w Jagiellońskiej Bibliotece Cyfrowej. Piotr Myszkowski Metadane w Jagiellońskiej Bibliotece Cyfrowej Piotr Myszkowski Informacje o obiektach w Jagiellońskiej Bibliotece Cyfrowej Dwa poziomy strukturyzacji informacji o obiektach odpowiadają dwóm podstawowym

Bardziej szczegółowo

AMINOKWASY. I. Wprowadzenie teoretyczne. Aminokwasy są to związki, które w łańcuchu węglowym zawierają zarówno grupę aminową jak i grupę karboksylową.

AMINOKWASY. I. Wprowadzenie teoretyczne. Aminokwasy są to związki, które w łańcuchu węglowym zawierają zarówno grupę aminową jak i grupę karboksylową. AMIKWASY I. Wprowadzenie teoretyczne Aminokwasy są to związki, które w łańcuchu węglowym zawierają zarówno grupę aminową jak i grupę karboksylową. 2 3 WZY GÓLE ATUALY AMIKWASÓW WYSTĘPUJĄY W BIAŁKA Zalicza

Bardziej szczegółowo

Białko w diecie sportowca

Białko w diecie sportowca Białko w diecie sportowca mgr. Joanna Misiorowska 1 mgr.joanna Misiorowska "Żywienie w sporcie" Białko na piedestale od zarania dziejów Dieta mięsna: połowa V wieku p. n. e. Model diety wysokobiałkowej

Bardziej szczegółowo

FILOGENETYKA. Bioinformatyka,, wykład 7 (29.XI.2007)

FILOGENETYKA. Bioinformatyka,, wykład 7 (29.XI.2007) FILOGENETYKA Bioinformatyka,, wykład 7 (29.XI.2007) Filogenetyka Cel rekonstrukcja historii ewolucji wszystkich organizmów. Klasyczne podejście: historia ewolucji jest odtwarzana

Bardziej szczegółowo

(12) TŁUMACZENIE PATENTU EUROPEJSKIEGO (19) PL (11) (96) Data i numer zgłoszenia patentu europejskiego:

(12) TŁUMACZENIE PATENTU EUROPEJSKIEGO (19) PL (11) (96) Data i numer zgłoszenia patentu europejskiego: RZECZPOSPOLITA POLSKA (12) TŁUMACZENIE PATENTU EUROPEJSKIEGO (19) PL (11) PL/EP 1623719 Urząd Patentowy Rzeczypospolitej Polskiej (96) Data i numer zgłoszenia patentu europejskiego: 03.0.04 047882.0 (97)

Bardziej szczegółowo



Bardziej szczegółowo

FILOGENETYKA. Bioinformatyka, wykład 7 (24.XI.200..XI.2008)

FILOGENETYKA. Bioinformatyka, wykład 7 (24.XI.200..XI.2008) FILOGENETYKA Bioinformatyka, wykład 7 (24.XI.200.XI.2008) Filogenetyka Cel rekonstrukcja historii ewolucji wszystkich organizmów. Klasyczne podejście: historia ewolucji jest

Bardziej szczegółowo

V Ogólnopolska Konferencja Naukowa ZARZĄDZANIE INFORMACJĄ W NAUCE

V Ogólnopolska Konferencja Naukowa ZARZĄDZANIE INFORMACJĄ W NAUCE V Ogólnopolska Konferencja Naukowa ZARZĄDZANIE INFORMACJĄ W NAUCE Katowice, 27 28 listopada 2014 Spis treści: 1. Informacje ogólne 2. Czasopisma w MathSciNet 3. Jednoznaczna identyfikacja autorów 4. System

Bardziej szczegółowo

WEB OF SCIENCE Wyszukiwanie cytowanych pozycji bibliograficznych Cited Reference Search

WEB OF SCIENCE Wyszukiwanie cytowanych pozycji bibliograficznych Cited Reference Search WEB OF SCIENCE Wyszukiwanie cytowanych pozycji bibliograficznych Cited Reference Search DR KLEMENTYNA KARLIŃSKA-BATRES Na czym polega wyszukiwanie cytowanych pozycji bibliograficznych? Zaczynamy od znanej

Bardziej szczegółowo

(12) TŁUMACZENIE PATENTU EUROPEJSKIEGO (19) PL (11) PL/EP (96) Data i numer zgłoszenia patentu europejskiego:

(12) TŁUMACZENIE PATENTU EUROPEJSKIEGO (19) PL (11) PL/EP (96) Data i numer zgłoszenia patentu europejskiego: RZECZPOSPOLITA POLSKA (12) TŁUMACZENIE PATENTU EUROPEJSKIEGO (19) PL (11) PL/EP 1648427 Urząd Patentowy Rzeczypospolitej Polskiej (96) Data i numer zgłoszenia patentu europejskiego: 17.05.2004 04752450.9

Bardziej szczegółowo

Aminokwasy, peptydy i białka. Związki wielofunkcyjne

Aminokwasy, peptydy i białka. Związki wielofunkcyjne Aminokwasy, peptydy i białka Związki wielofunkcyjne Aminokwasy, peptydy i białka Aminokwasy, peptydy i białka: - wiadomości ogólne Aminokwasy: - ogólna charakterystyka - budowa i nazewnictwo - właściwości

Bardziej szczegółowo

Krok 3: Przeszukiwanie baz projektów europejskich

Krok 3: Przeszukiwanie baz projektów europejskich Zbadaj innowacyjność swojego pomysłu badawczego Krok 3: Przeszukiwanie baz projektów europejskich Angelika Łysiak Regionalne Centrum Innowacji i Transferu Technologii Zachodniopomorski Uniwersytet Technologiczny

Bardziej szczegółowo

Materiały pochodzą z Platformy Edukacyjnej Portalu

Materiały pochodzą z Platformy Edukacyjnej Portalu Materiały pochodzą z Platformy Edukacyjnej Portalu Wszelkie treści i zasoby edukacyjne publikowane na łamach Portalu mogą byd wykorzystywane przez jego Użytkowników

Bardziej szczegółowo

Metabolizm wysiłkowy białek. Zajęcia nr 2

Metabolizm wysiłkowy białek. Zajęcia nr 2 Metabolizm wysiłkowy białek Zajęcia nr 2 Źródła aminokwasów białko pokarmowe aminokwasy Hydroliza w przewodzie pokarmowym krew aminokwasy synteza białko mięsień Trawienie białek w przewodzie pokarmowym

Bardziej szczegółowo

EWOLUCJA GENOMÓW. Bioinformatyka, wykład 7 (29.XI.2010)

EWOLUCJA GENOMÓW. Bioinformatyka, wykład 7 (29.XI.2010) EWOLUCJA GENOMÓW Bioinformatyka, wykład 7 (29.XI.2010) Wykład 7 spis treści świat wirusów (?) ewolucja genomów GENOMIKA badanie struktury i funkcjonowania genomów GENOMIKA STRUKTURALNA

Bardziej szczegółowo

Narzędzie do analizy sekwencji BLAST

Narzędzie do analizy sekwencji BLAST Narzędzie do analizy sekwencji BLAST (Rozdział 16) Streszczenie Porównanie sekwencji nukleotydów lub białek tych samych lub różnych organizmów jest bardzo potężnym narzędziem w biologii molekularnej. Poprzez

Bardziej szczegółowo


AMINOKWASY BUDOWA I WŁAŚCIWOŚCI BIAŁKA BUDOWA I FUNKCJE Ćwiczenie 1 AMINOKWASY BUDOWA I WŁAŚCIWOŚCI BIAŁKA BUDOWA I FUNKCJE Część doświadczalna obejmuje: rozdział aminokwasów metodą chromatografii podziałowej (technika chromatografii bibułowej wstępującej)

Bardziej szczegółowo

właściwości i zalety

właściwości i zalety właściwości i zalety Funkcje aminokwasów Kwas asparginowy, Treonina Kwas glutaminowy Arginina Cysteina, Histydyna Fenyloalanina Glicyna Alanina Lizyna Metionina Prolina i hydroksyprolina Seryna Tryptofan,

Bardziej szczegółowo

Sygnalizacja_Damian_Szymon / PLC_1 [CPU 1214C DC/DC/DC] / Program blocks

Sygnalizacja_Damian_Szymon / PLC_1 [CPU 1214C DC/DC/DC] / Program blocks Sygnalizacja_Damian_Szymon / PLC_1 [CPU 1214C DC/DC/DC] / Program blocks Main [OB1] Main Properties General Name Main Number 1 Type Language LAD Information Title "Main Program Sweep (Cycle)" Author Family

Bardziej szczegółowo

Historia Bioinformatyki

Historia Bioinformatyki Historia Bioinformatyki 1859 Darwin i Wallace opublikowali O powstaniu gatunku 1865 Mendel eksperymentując z grochem, wykazuje, że cechy dziedziczą się w odrębnych jednostkach 1869 Meischer wyizolował

Bardziej szczegółowo

(12) TŁUMACZENIE PATENTU EUROPEJSKIEGO (19) PL (11) PL/EP (96) Data i numer zgłoszenia patentu europejskiego:

(12) TŁUMACZENIE PATENTU EUROPEJSKIEGO (19) PL (11) PL/EP (96) Data i numer zgłoszenia patentu europejskiego: RZECZPOSPOLITA POLSKA (12) TŁUMACZENIE PATENTU EUROPEJSKIEGO (19) PL (11) PL/EP 1861493 Urząd Patentowy Rzeczypospolitej Polskiej (96) Data i numer zgłoszenia patentu europejskiego: 17.03.2006 06725146.2

Bardziej szczegółowo

Elementy bioinformatyki. Aminokwasy, białka, receptory. Andrzej Bąk Instytut Chemii UŚ chemoinformatyka wykład 1

Elementy bioinformatyki. Aminokwasy, białka, receptory. Andrzej Bąk Instytut Chemii UŚ chemoinformatyka wykład 1 Elementy bioinformatyki. Aminokwasy, białka, receptory Andrzej Bąk Instytut Chemii UŚ chemoinformatyka wykład 1 Tematy istoria odkrywania białek Budowa białek Budowa aminokwasów Właściwości aminokwasów

Bardziej szczegółowo

The Dublin Core Metadata Element Set, Ver. 1.1 a potrzeby i oczekiwania bibliotekarzy cyfrowych - analiza przypadków

The Dublin Core Metadata Element Set, Ver. 1.1 a potrzeby i oczekiwania bibliotekarzy cyfrowych - analiza przypadków The Dublin Core Metadata Element Set, Ver. 1.1 a potrzeby i oczekiwania bibliotekarzy cyfrowych - analiza przypadków Joanna Potęga Biblioteka Narodowa Agnieszka Wróbel Biblioteka Uniwersytecka w Warszawie

Bardziej szczegółowo

Od jakiego pułapu startujemy? matematyka

Od jakiego pułapu startujemy? matematyka dla biotechnologów Wykład 2 Definicja bioinformatyki Od jakiego pułapu startujemy? Zakładamy, że te pojęcia są w małym palcu: DNA, RNA struktura, funkcje, rodzaje Genom Białka struktury, funkcje, rodzaje,

Bardziej szczegółowo

Samouczek: Konstruujemy drzewo

Samouczek: Konstruujemy drzewo ROZDZIAŁ 2 Samouczek: Konstruujemy drzewo Po co nam drzewa filogenetyczne? Drzewa filogenetyczne często pojawiają się dzisiaj w pracach z dziedziny biologii molekularnej, które nie mają związku z filogenetyką

Bardziej szczegółowo

Ł Ź Ą Ż Ż Ź Ł Ż Ć Ć Ż Ż ć Ź Ż Ż Ż Ć Ż Ć ź ć Ż ż ż Ż Ż ć Ż ż Ż Ż Ż ć Ż ż ć Ć ź Ą Ż Ż ż ć Ź Ż ż Ą Ą Ż ć Ź ź Ż ź ć Ą ć ć ż ż ź ź ć ć ż ż ż ź ć ć Ą ż Ą ż ż Ż Ż Ż ć ż Ż ć ż Ł Ż Ą Ż ź ż ć Ż Ż Ż Ć Ź Ź Ż Ą ć

Bardziej szczegółowo

ISBN 978-83-89244-90-1

ISBN 978-83-89244-90-1 ISBN 978-83-89244-90-1 9 788389 244901 Notka biograficzna Aleksandra Gruca jest inżynierem, bioinformatykiem. Od początku swojej pracy naukowej koncentruje się na zagadnieniach związanych z zastosowaniem

Bardziej szczegółowo

Oddziaływanie leków z celami molekularnymi i projektowanie leków

Oddziaływanie leków z celami molekularnymi i projektowanie leków Oddziaływanie leków z celami molekularnymi i projektowanie leków Prof. dr hab. Sławomir Filipek Grupa BIOmodelowania ( Uniwersytet Warszawski, Wydział Chemii oraz Centrum Nauk Biologiczno-Chemicznych

Bardziej szczegółowo

Generowanie struktury trójwymiarowej białka dla zadanych wartości katow dwuściennych Phi, Psi.

Generowanie struktury trójwymiarowej białka dla zadanych wartości katow dwuściennych Phi, Psi. Wydział Fizyki i Informatyki Stosowanej Praca inżynierska Zbigniew Baster kierunek studiów: Fizyk Medyczna Generowanie struktury trójwymiarowej białka dla zadanych wartości katow dwuściennych Phi, Psi.

Bardziej szczegółowo

BIOINFORMATYKA. edycja 2015. wykład 2 BAZY DANYCH. dr Jacek Śmietański

BIOINFORMATYKA. edycja 2015. wykład 2 BAZY DANYCH. dr Jacek Śmietański BIOINFORMATYKA edycja 2015 wykład 2 BAZY DANYCH dr Jacek Śmietański slajd 1 Tło: mioglobina Myoglobin was the first protein visualized in three

Bardziej szczegółowo